uPAR Antibody

Western Blot: uPAR Antibody [H00005329-B01P] - Analysis of PLAUR expression in transfected 293T cell line by PLAUR polyclonal antibody. Lane 1: PLAUR transfected lysate(36.85 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

uPAR Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PLAUR (NP_002650.1, 1 a.a. - 335 a.a.) full-length human protein. MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
• Specificity: PLAUR - plasminogen activator, urokinase receptor,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PLAUR
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for uPAR Antibody

• CD87 antigen
• CD87
• Monocyte activation antigen Mo3
• plasminogen activator, urokinase receptor
• PLAUR
• uPAR
• U-PAR
• UPARurokinase plasminogen activator surface receptor
• u-plasminogen activator receptor form 2
• URKRMO3

Background

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for uPAR Antibody (H00005329-B01P)(1)

Publication using H00005329-B01P

• Y Cheng, TR Hall, X Xu, I Yung, D Souza, J Zheng, F Schiele, M Hoffmann, ML Mbow, JP Garnett, J Li Targeting uPA-uPAR interaction to improve intestinal epithelial barrier integrity in inflammatory bowel disease EBioMedicine, 2021-12-18;75(0):103758. 2021-12-18 [PMID: 34933179]

Bioinformatics

• Gene Symbol: PLAUR
• Entrez:
  • 5329(Human)
• Uniprot:
  • NP_002650.1(Human)