uPAR Antibody

Images

 
Western Blot: uPAR Antibody [H00005329-B01P] - Analysis of PLAUR expression in transfected 293T cell line by PLAUR polyclonal antibody. Lane 1: PLAUR transfected lysate(36.85 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

uPAR Antibody Summary

Immunogen
PLAUR (NP_002650.1, 1 a.a. - 335 a.a.) full-length human protein. MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Specificity
PLAUR - plasminogen activator, urokinase receptor,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PLAUR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for uPAR Antibody

  • CD87 antigen
  • CD87
  • Monocyte activation antigen Mo3
  • plasminogen activator, urokinase receptor
  • PLAUR
  • uPAR
  • U-PAR
  • UPARurokinase plasminogen activator surface receptor
  • u-plasminogen activator receptor form 2
  • URKRMO3

Background

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu

Publications for uPAR Antibody (H00005329-B01P) (0)

There are no publications for uPAR Antibody (H00005329-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for uPAR Antibody (H00005329-B01P) (0)

There are no reviews for uPAR Antibody (H00005329-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for uPAR Antibody (H00005329-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional uPAR Products

Bioinformatics Tool for uPAR Antibody (H00005329-B01P)

Discover related pathways, diseases and genes to uPAR Antibody (H00005329-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for uPAR Antibody (H00005329-B01P)

Discover more about diseases related to uPAR Antibody (H00005329-B01P).
 

Pathways for uPAR Antibody (H00005329-B01P)

View related products by pathway.

PTMs for uPAR Antibody (H00005329-B01P)

Learn more about PTMs related to uPAR Antibody (H00005329-B01P).

Blogs on uPAR

There are no specific blogs for uPAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our uPAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAUR
Entrez
Uniprot