UNC5H2/UNC5B Antibody (1A9)

Images

 
Sandwich ELISA: UNC5H2/UNC5B Antibody (1A9) [H00219699-M01] - Detection limit for recombinant GST tagged UNC5B is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UNC5H2/UNC5B Antibody (1A9) Summary

Immunogen
UNC5B (NP_734465, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY
Localization
Membrane; Single-pass type I membrane protein.
Specificity
UNC5B - unc-5 homolog B (C. elegans)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UNC5B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using
H00219699-M01 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UNC5H2/UNC5B Antibody (1A9)

  • p53RDL1
  • p53-regulated receptor for death and life protein 1
  • Protein unc-5 homolog 2
  • Protein unc-5 homolog B
  • transmembrane receptor Unc5H2
  • unc5 (C.elegans homolog) b
  • unc-5 homolog 2
  • unc-5 homolog B (C. elegans)
  • UNC5B
  • UNC5H2
  • UNC5H2netrin receptor UNC5B

Background

UNC5B belongs to a family of netrin 1 receptors thought to mediate the chemorepulsive effect of netrin 1 on specific axons. Unc5B is required for axon guidance. It mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1109-N1/CF
Species: Mu
Applications: Bind
AF844
Species: Mu
Applications: Block, IHC, WB
AF1005
Species: Hu
Applications: IHC, WB
AF1405
Species: Rt
Applications: Block, ICC, WB
AF1079
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-82518
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1429
Species: Hu
Applications: WB
AF1132
Species: Mu
Applications: Block, IHC, WB
NB300-126
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-24498
Species: Ca, Eq, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for UNC5H2/UNC5B Antibody (H00219699-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UNC5H2/UNC5B Antibody (H00219699-M01) (0)

There are no reviews for UNC5H2/UNC5B Antibody (H00219699-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC5H2/UNC5B Antibody (H00219699-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNC5H2/UNC5B Products

Bioinformatics Tool for UNC5H2/UNC5B Antibody (H00219699-M01)

Discover related pathways, diseases and genes to UNC5H2/UNC5B Antibody (H00219699-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC5H2/UNC5B Antibody (H00219699-M01)

Discover more about diseases related to UNC5H2/UNC5B Antibody (H00219699-M01).
 

Pathways for UNC5H2/UNC5B Antibody (H00219699-M01)

View related products by pathway.

PTMs for UNC5H2/UNC5B Antibody (H00219699-M01)

Learn more about PTMs related to UNC5H2/UNC5B Antibody (H00219699-M01).
 

Research Areas for UNC5H2/UNC5B Antibody (H00219699-M01)

Find related products by research area.

Blogs on UNC5H2/UNC5B

There are no specific blogs for UNC5H2/UNC5B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNC5H2/UNC5B Antibody (1A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC5B
Entrez
OMIM
Uniprot