UNC5H1/Unc5a Antibody

Immunocytochemistry/Immunofluorescence: UNC5H1/Unc5a Antibody [NBP2-57451] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Product Discontinued

UNC5H1/Unc5a Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSPSTSDLACKLWVWQVEGDGQSFSINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIIS
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UNC5H1/Unc5a Antibody

• KIAA1976netrin receptor UNC5A
• netrin receptor Unc5h1
• Protein unc-5 homolog 1
• Protein unc-5 homolog A
• unc5 (C.elegans homolog) a
• unc-5 homolog 1
• unc-5 homolog A (C. elegans)
• UNC5A
• UNC5H1
• UNC5H1FLJ16449

Background

UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UNC5A