Recombinant Human UNC119 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UNC119 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-240 of Human UNC119 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UNC119

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UNC119 Protein

  • hRG4
  • HRG4POC7 centriolar protein homolog A
  • POC7
  • POC7A
  • protein unc-119 homolog A
  • Retinal protein 4
  • RG4
  • unc119 (C.elegans) homolog
  • unc-119 homolog (C. elegans)

Background

UNC119( AAH27176, 1 a.a. - 241 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-46542
Species: Hu
Applications: WB, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF

Publications for UNC119 Recombinant Protein (H00009094-P01) (0)

There are no publications for UNC119 Recombinant Protein (H00009094-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC119 Recombinant Protein (H00009094-P01) (0)

There are no reviews for UNC119 Recombinant Protein (H00009094-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC119 Recombinant Protein (H00009094-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UNC119 Products

Bioinformatics Tool for UNC119 Recombinant Protein (H00009094-P01)

Discover related pathways, diseases and genes to UNC119 Recombinant Protein (H00009094-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC119 Recombinant Protein (H00009094-P01)

Discover more about diseases related to UNC119 Recombinant Protein (H00009094-P01).
 

Pathways for UNC119 Recombinant Protein (H00009094-P01)

View related products by pathway.

PTMs for UNC119 Recombinant Protein (H00009094-P01)

Learn more about PTMs related to UNC119 Recombinant Protein (H00009094-P01).
 

Research Areas for UNC119 Recombinant Protein (H00009094-P01)

Find related products by research area.

Blogs on UNC119

There are no specific blogs for UNC119, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UNC119 Antibody (2F9-2A9)
H00009094-M01-100ug
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UNC119 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC119