ULK2 Antibody

Images

 
Western Blot: ULK2 Antibody [NBP1-88881] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ULK2 Antibody [NBP1-88881] - Staining of human urinary bladder shows cytoplasmic and membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: ULK2 Antibody [NBP1-88881] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ULK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTSPTKH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ULK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ULK2 Recombinant Protein Antigen (NBP1-88881PEP)
Publications
Read Publications using
NBP1-88881 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24923441).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ULK2 Antibody

  • ATG1B
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0623serine/threonine-protein kinase ULK2
  • unc-51 (C. elegans)-like kinase 2
  • Unc51.2
  • unc-51-like kinase 2 (C. elegans)
  • Unc-51-like kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-77279
Species: Hu, Mu
Applications: WB, IP
NBP2-52419
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-34046
Species: Hu
Applications: WB, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-331
Species: Hu, Mu, Rt
Applications: IP (-), WB
NBP1-88877
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB4069
Species: Hu, Mu, Rt
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ULK2 Antibody (NBP1-88881)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for ULK2 Antibody (NBP1-88881) (0)

There are no reviews for ULK2 Antibody (NBP1-88881). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ULK2 Antibody (NBP1-88881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ULK2 Products

Bioinformatics Tool for ULK2 Antibody (NBP1-88881)

Discover related pathways, diseases and genes to ULK2 Antibody (NBP1-88881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ULK2 Antibody (NBP1-88881)

Discover more about diseases related to ULK2 Antibody (NBP1-88881).
 

Pathways for ULK2 Antibody (NBP1-88881)

View related products by pathway.

PTMs for ULK2 Antibody (NBP1-88881)

Learn more about PTMs related to ULK2 Antibody (NBP1-88881).
 

Research Areas for ULK2 Antibody (NBP1-88881)

Find related products by research area.

Blogs on ULK2

There are no specific blogs for ULK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ULK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ULK2