ULK2 Antibody (2A12)

Images

 
Immunocytochemistry/ Immunofluorescence: ULK2 Antibody (2A12) [H00009706-M05] - Analysis of monoclonal antibody to ULK2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: ULK2 Antibody (2A12) [H00009706-M05] - Detection limit for recombinant GST tagged ULK2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ULK2 Antibody (2A12) Summary

Immunogen
ULK2 (AAH34988, 743 a.a. ~ 843 a.a) partial recombinant protein with GST tag.FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGA EAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDT LRHLNVMLMFTECVLDL
Specificity
ULK2 - unc-51-like kinase 2 (C. elegans)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ULK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ULK2 Antibody (2A12)

  • ATG1B
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0623serine/threonine-protein kinase ULK2
  • unc-51 (C. elegans)-like kinase 2
  • Unc51.2
  • unc-51-like kinase 2 (C. elegans)
  • Unc-51-like kinase 2

Background

This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a central proline/serine rich (PS) domain, and a C-terminal (C) domain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-77279
Species: Hu, Mu
Applications: WB, IP
NBP2-52419
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-34046
Species: Hu
Applications: WB, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-331
Species: Hu, Mu, Rt
Applications: IP (-), WB
NBP1-88877
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB4069
Species: Hu, Mu, Rt
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ULK2 Antibody (H00009706-M05) (0)

There are no publications for ULK2 Antibody (H00009706-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ULK2 Antibody (H00009706-M05) (0)

There are no reviews for ULK2 Antibody (H00009706-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ULK2 Antibody (H00009706-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ULK2 Products

Bioinformatics Tool for ULK2 Antibody (H00009706-M05)

Discover related pathways, diseases and genes to ULK2 Antibody (H00009706-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ULK2 Antibody (H00009706-M05)

Discover more about diseases related to ULK2 Antibody (H00009706-M05).
 

Pathways for ULK2 Antibody (H00009706-M05)

View related products by pathway.

PTMs for ULK2 Antibody (H00009706-M05)

Learn more about PTMs related to ULK2 Antibody (H00009706-M05).
 

Research Areas for ULK2 Antibody (H00009706-M05)

Find related products by research area.

Blogs on ULK2

There are no specific blogs for ULK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ULK2 Antibody (2A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ULK2
Entrez
OMIM
Uniprot