UHRF1 Recombinant Protein Antigen

Images

 
There are currently no images for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UHRF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UHRF1

Source: E.coli

Amino Acid Sequence: VFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UHRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13504. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UHRF1 Recombinant Protein Antigen

  • E3 ubiquitin-protein ligase UHRF1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ21925
  • hNp95
  • hUHRF1
  • HuNp95
  • ICBP90
  • ICBP90NP95
  • Inverted CCAAT box-binding protein of 90 kDa
  • NP95
  • Nuclear protein 95
  • Nuclear zinc finger protein Np95
  • RING finger protein 106
  • RNF106
  • RNF106MGC138707
  • Transcription factor ICBP90
  • Ubiquitin-like PHD and RING finger domain-containing protein 1
  • ubiquitin-like with PHD and ring finger domains 1
  • ubiquitin-like, containing PHD and RING finger domains, 1
  • Ubiquitin-like-containing PHD and RING finger domains protein 1
  • UHRF1

Background

UHRF1 encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-86734
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-00092
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, PLA, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-01367
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-18933
Species: Hu, Mu
Applications: IP, WB
DVE00
Species: Hu
Applications: ELISA
AF1709
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
PP-A8620A-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84161
Species: Hu
Applications: IHC,  IHC-P
NBP2-13504PEP
Species: Hu
Applications: AC

Publications for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP) (0)

There are no publications for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP) (0)

There are no reviews for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UHRF1 Products

Research Areas for UHRF1 Recombinant Protein Antigen (NBP2-13504PEP)

Find related products by research area.

Blogs on UHRF1.

Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation
By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UHRF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF1