Recombinant Human UHRF1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human UHRF1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 694-793 of Human UHRF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
UHRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UHRF1 GST (N-Term) Protein

  • E3 ubiquitin-protein ligase UHRF1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ21925
  • hNp95
  • hUHRF1
  • HuNp95
  • ICBP90
  • ICBP90NP95
  • Inverted CCAAT box-binding protein of 90 kDa
  • NP95
  • Nuclear protein 95
  • Nuclear zinc finger protein Np95
  • RING finger protein 106
  • RNF106
  • RNF106MGC138707
  • Transcription factor ICBP90
  • Ubiquitin-like PHD and RING finger domain-containing protein 1
  • ubiquitin-like with PHD and ring finger domains 1
  • ubiquitin-like, containing PHD and RING finger domains, 1
  • Ubiquitin-like-containing PHD and RING finger domains protein 1
  • UHRF1

Background

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-86734
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-00092
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, PLA, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-01367
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-18933
Species: Hu, Mu
Applications: IP, WB
DVE00
Species: Hu
Applications: ELISA
AF1709
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
PP-A8620A-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84161
Species: Hu
Applications: IHC,  IHC-P
H00029128-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for UHRF1 Partial Recombinant Protein (H00029128-Q01) (0)

There are no publications for UHRF1 Partial Recombinant Protein (H00029128-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UHRF1 Partial Recombinant Protein (H00029128-Q01) (0)

There are no reviews for UHRF1 Partial Recombinant Protein (H00029128-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UHRF1 Partial Recombinant Protein (H00029128-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UHRF1 Products

Research Areas for UHRF1 Partial Recombinant Protein (H00029128-Q01)

Find related products by research area.

Blogs on UHRF1.

Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation
By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UHRF1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF1