UGT3A1 Antibody

Images

 
Immunohistochemistry: UGT3A1 Antibody [NBP2-31025] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT3A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT3A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UGT3A1 Protein (NBP2-31025PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UGT3A1 Antibody

  • EC 2.4.1
  • EC 2.4.1.17
  • FLJ26528
  • FLJ34658
  • UDP glycosyltransferase 3 family, polypeptide A1
  • UDP-glucuronosyltransferase 3A1
  • UDPGT 3A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-06724
Species: Hu
NBP2-32468
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-69412
Species: Hu
Applications: WB
NBP1-91336
Species: Hu
Applications: WB
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84494
Species: Hu
Applications: IHC, IHC-P
NBP2-20803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94148
Species: Hu
Applications: IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-31025
Species: Hu
Applications: IHC, IHC-P

Publications for UGT3A1 Antibody (NBP2-31025) (0)

There are no publications for UGT3A1 Antibody (NBP2-31025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT3A1 Antibody (NBP2-31025) (0)

There are no reviews for UGT3A1 Antibody (NBP2-31025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UGT3A1 Antibody (NBP2-31025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT3A1 Products

Bioinformatics Tool for UGT3A1 Antibody (NBP2-31025)

Discover related pathways, diseases and genes to UGT3A1 Antibody (NBP2-31025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT3A1 Antibody (NBP2-31025)

Discover more about diseases related to UGT3A1 Antibody (NBP2-31025).
 

Pathways for UGT3A1 Antibody (NBP2-31025)

View related products by pathway.

PTMs for UGT3A1 Antibody (NBP2-31025)

Learn more about PTMs related to UGT3A1 Antibody (NBP2-31025).
 

Research Areas for UGT3A1 Antibody (NBP2-31025)

Find related products by research area.

Blogs on UGT3A1

There are no specific blogs for UGT3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT3A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT3A1
Uniprot