UGT2B7 Antibody (8D12) - Azide and BSA Free

Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Detection against Immunogen (35.53 KDa) .

Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Analysis of UGT2B7 expression in transfected 293T cell line by UGT2B7 monoclonal antibody (M02), clone 8D12. Lane 1: UGT2B7 transfected lysate (Predicted MW: 58.19 KDa). Lane 2: Non-transfected lysate.

Western Blot: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Monoclonal antibody (M02), clone 8D12. Western Blot analysis of UGT2B7 expression in PC-12.

ELISA: UGT2B7 Antibody (8D12) [H00007364-M02-100ug] - Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 8D12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UGT2B7 Antibody (8D12) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse UGT2B7 Antibody (8D12) - Azide and BSA Free (H00007364-M02-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: UGT2B7 (NP_001065, 69 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UGT2B7
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGT2B7 Antibody (8D12) - Azide and BSA Free

• UDP glucuronosyltransferase 2 family, polypeptide B73,4-catechol estrogen specific
• UDP glycosyltransferase 2 family, polypeptide B7
• UGT2B9family 2, beta-7
• UGTB2B9

Background

UGT2B7 - UDP glycosyltransferase 2 family, polypeptide B7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UGT2B7
• Entrez:
  • 7364(Human)
• OMIM:
  • 600068(Human)
• Uniprot:
  • NP_001065(Human)