UGT2B4 Antibody (2H6)

Images

 
Immunocytochemistry/ Immunofluorescence: UGT2B4 Antibody (2H6) [H00007363-M01] - Analysis of monoclonal antibody to UGT2B4 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: UGT2B4 Antibody (2H6) [H00007363-M01] - Detection limit for recombinant GST tagged UGT2B4 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UGT2B4 Antibody (2H6) Summary

Immunogen
UGT2B4 (NP_066962.1, 25 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILR
Specificity
UGT2B4 - UDP glucuronosyltransferase 2 family, polypeptide B4 (2H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UGT2B4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGT2B4 Antibody (2H6)

  • family 2, beta-4
  • UDP glucuronosyltransferase 2 family, polypeptide B4
  • UDP glycosyltransferase 2 family, polypeptide B4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H00007366-B01P
Species: Hu
Applications: WB
NBP1-69412
Species: Hu
Applications: WB
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
NBP2-06724
Species: Hu
NBP2-08443
Species: Hu
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-59786
Species: Hu
Applications: WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for UGT2B4 Antibody (H00007363-M01) (0)

There are no publications for UGT2B4 Antibody (H00007363-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B4 Antibody (H00007363-M01) (0)

There are no reviews for UGT2B4 Antibody (H00007363-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UGT2B4 Antibody (H00007363-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT2B4 Products

UGT2B4 H00007363-M01

Bioinformatics Tool for UGT2B4 Antibody (H00007363-M01)

Discover related pathways, diseases and genes to UGT2B4 Antibody (H00007363-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B4 Antibody (H00007363-M01)

Discover more about diseases related to UGT2B4 Antibody (H00007363-M01).
 

Pathways for UGT2B4 Antibody (H00007363-M01)

View related products by pathway.

PTMs for UGT2B4 Antibody (H00007363-M01)

Learn more about PTMs related to UGT2B4 Antibody (H00007363-M01).

Blogs on UGT2B4

There are no specific blogs for UGT2B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT2B4 Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT2B4
Entrez
Uniprot