UGP2 Antibody

Images

 
Western Blot: UGP2 Antibody [H00007360-D01P] - Analysis of UGP2 expression in human liver.
Immunocytochemistry/ Immunofluorescence: UGP2 Antibody [H00007360-D01P] - Analysis of antibody to UGP2 on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: UGP2 Antibody [H00007360-D01P] - Analysis of UGP2 expression in HepG2.
Western Blot: UGP2 Antibody [H00007360-D01P] - Analysis of UGP2 expression in transfected 293T cell line by UGP2 polyclonal antibody.Lane 1: UGP2 transfected lysate(56.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGP2 Antibody Summary

Immunogen
UGP2 (NP_006750.3, 1 a.a. - 508 a.a.) full-length human protein. MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGP2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGP2 Antibody

  • EC 2.7.7.9
  • pHC379
  • UDPG
  • UDP-glucose diphosphorylase
  • UDP-glucose pyrophosphorylase 2
  • UDP-glucose pyrophosphorylase
  • UDPGP
  • UDPGP2
  • UGP1
  • UGPase 2
  • UGPase
  • UGPP2
  • uridyl diphosphate glucose pyrophosphorylase 2
  • UTP-glucose-1-phosphate uridyltransferase
  • UTP--glucose-1-phosphate uridylyltransferase 2
  • UTP--glucose-1-phosphate uridylyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-61753
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
6144-GH
Species: Hu
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58490
Species: Hu
Applications: ICC/IF
NB100-41419
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00007360-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for UGP2 Antibody (H00007360-D01P) (0)

There are no publications for UGP2 Antibody (H00007360-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGP2 Antibody (H00007360-D01P) (0)

There are no reviews for UGP2 Antibody (H00007360-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UGP2 Antibody (H00007360-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UGP2 Antibody (H00007360-D01P)

Discover related pathways, diseases and genes to UGP2 Antibody (H00007360-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGP2 Antibody (H00007360-D01P)

Discover more about diseases related to UGP2 Antibody (H00007360-D01P).
 

Pathways for UGP2 Antibody (H00007360-D01P)

View related products by pathway.

Research Areas for UGP2 Antibody (H00007360-D01P)

Find related products by research area.

Blogs on UGP2

There are no specific blogs for UGP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGP2
Uniprot