Uev1a/UBE2V1 Antibody

Images

 
Western Blot: Uev1a/UBE2V1 Antibody [H00007335-B01P] - Analysis of UBE2V1 expression in human pancreas.
Immunocytochemistry/ Immunofluorescence: Uev1a/UBE2V1 Antibody [H00007335-B01P] - Analysis of purified antibody to UBE2V1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Uev1a/UBE2V1 Antibody [H00007335-B01P] - Analysis of UBE2V1 expression in transfected 293T cell line by UBE2V1 polyclonal antibody. Lane 1: UBE2V1 transfected lysate(16.28 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Uev1a/UBE2V1 Antibody Summary

Immunogen
UBE2V1 (AAH00468, 1 a.a. - 147 a.a.) full-length human protein. MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UBE2V1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Uev1a/UBE2V1 Antibody

  • CIR1
  • CROC1
  • CROC1TRAF6-regulated IKK activator 1 beta Uev1A
  • CROC-1UBE2V
  • UBE2V1
  • ubiquitin-conjugating enzyme E2 variant 1
  • Uev1a
  • UEV-1CIR1
  • UEV1DNA-binding protein

Background

Please note, this antibody is considered to be Innovators Grade. Innovators Grade antibodies have been validated for limited uses and require additional characterization for most new species/applications. These antibodies are directed against antigens that have limited or no commercial antibodies available for them, or for which there are limited expression data available to us. In an effort to encourage customer feedback, Novus has made these antibodies available through our Innovators Reward program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data. Please contact us at innovators@novusbio.com for more details. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts encoding different isoforms have been described for this gene. A pseudogene has been identified which is also located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56357
Species: Hu
Applications: WB, IP
NBP2-26506
Species: Hu, Mu, Rt
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56360
Species: Hu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56363
Species: Hu, Mu
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
E2-627
Species: Hu
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC

Publications for Uev1a/UBE2V1 Antibody (H00007335-B01P) (0)

There are no publications for Uev1a/UBE2V1 Antibody (H00007335-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uev1a/UBE2V1 Antibody (H00007335-B01P) (0)

There are no reviews for Uev1a/UBE2V1 Antibody (H00007335-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Uev1a/UBE2V1 Antibody (H00007335-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uev1a/UBE2V1 Products

Bioinformatics Tool for Uev1a/UBE2V1 Antibody (H00007335-B01P)

Discover related pathways, diseases and genes to Uev1a/UBE2V1 Antibody (H00007335-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uev1a/UBE2V1 Antibody (H00007335-B01P)

Discover more about diseases related to Uev1a/UBE2V1 Antibody (H00007335-B01P).
 

Pathways for Uev1a/UBE2V1 Antibody (H00007335-B01P)

View related products by pathway.

PTMs for Uev1a/UBE2V1 Antibody (H00007335-B01P)

Learn more about PTMs related to Uev1a/UBE2V1 Antibody (H00007335-B01P).

Blogs on Uev1a/UBE2V1

There are no specific blogs for Uev1a/UBE2V1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uev1a/UBE2V1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2V1
Entrez
Uniprot