UBTF Recombinant Protein Antigen

Images

 
There are currently no images for UBTF Recombinant Protein Antigen (NBP1-82545PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UBTF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBTF.

Source: E.coli

Amino Acid Sequence: WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBTF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82545.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for UBTF Recombinant Protein Antigen

  • 90-KDa Nucleolus Organizer Region Autoantigen
  • Autoantigen NOR-90
  • NOR-90
  • nucleolar transcription factor 1
  • UBF
  • UBF1
  • UBF-1
  • UBF2
  • UBFUBF-1
  • upstream binding transcription factor, RNA polymerase I
  • Upstream-binding factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58841
Species: Hu
Applications: ICC/IF
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM, ICC
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-89867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-43633
Species: Hu
Applications: WB, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for UBTF Recombinant Protein Antigen (NBP1-82545PEP) (0)

There are no publications for UBTF Recombinant Protein Antigen (NBP1-82545PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBTF Recombinant Protein Antigen (NBP1-82545PEP) (0)

There are no reviews for UBTF Recombinant Protein Antigen (NBP1-82545PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for UBTF Recombinant Protein Antigen (NBP1-82545PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for UBTF Recombinant Protein Antigen (NBP1-82545PEP)

Discover related pathways, diseases and genes to UBTF Recombinant Protein Antigen (NBP1-82545PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBTF Recombinant Protein Antigen (NBP1-82545PEP)

Discover more about diseases related to UBTF Recombinant Protein Antigen (NBP1-82545PEP).
 

Pathways for UBTF Recombinant Protein Antigen (NBP1-82545PEP)

View related products by pathway.

PTMs for UBTF Recombinant Protein Antigen (NBP1-82545PEP)

Learn more about PTMs related to UBTF Recombinant Protein Antigen (NBP1-82545PEP).

Blogs on UBTF

There are no specific blogs for UBTF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UBTF Antibody
NBP1-82545

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBTF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBTF