UBR2 Antibody (4G4) Summary
Immunogen |
UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG |
Specificity |
UBR2 - ubiquitin protein ligase E3 component n-recognin 2 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
UBR2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
- RNA Inhibition
- Sandwich ELISA
|
Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for UBR2 Antibody (4G4)
Background
Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Publications for UBR2 Antibody (H00023304-M01) (0)
There are no publications for UBR2 Antibody (H00023304-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UBR2 Antibody (H00023304-M01) (0)
There are no reviews for UBR2 Antibody (H00023304-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UBR2 Antibody (H00023304-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional UBR2 Products
Bioinformatics Tool for UBR2 Antibody (H00023304-M01)
Discover related pathways, diseases and genes to UBR2 Antibody (H00023304-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for UBR2 Antibody (H00023304-M01)
Discover more about diseases related to UBR2 Antibody (H00023304-M01).
| | Pathways for UBR2 Antibody (H00023304-M01)
View related products by pathway.
|
PTMs for UBR2 Antibody (H00023304-M01)
Learn more about PTMs related to UBR2 Antibody (H00023304-M01).
|
Blogs on UBR2