UBR2 Antibody (4G4)

Images

 
Western Blot: UBR2 Antibody (4G4) [H00023304-M01] - Analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01), clone 4G4.Lane 1: UBR2 transfected lysate(50 KDa).Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: UBR2 Antibody (4G4) [H00023304-M01] - Analysis of monoclonal antibody to UBR2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: UBR2 Antibody (4G4) [H00023304-M01] - Analysis of UBR2 over-expressed 293 cell line, cotransfected with UBR2 Validated Chimera RNAi ( Cat # H00023304-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: UBR2 Antibody (4G4) [H00023304-M01] - Detection limit for recombinant GST tagged UBR2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi, S-ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBR2 Antibody (4G4) Summary

Immunogen
UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
Specificity
UBR2 - ubiquitin protein ligase E3 component n-recognin 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBR2 Antibody (4G4)

  • bA49A4.1
  • C6orf133MGC71112
  • chromosome 6 open reading frame 133
  • dJ242G1.1
  • dJ392M17.3
  • DKFZp686C08114
  • E3 ubiquitin-protein ligase UBR2
  • EC 6.3.2.-
  • KIAA0349FLJ36357
  • N-recognin-2
  • RP3-392M17.3
  • ubiquitin protein ligase E3 component n-recognin 2
  • Ubiquitin-protein ligase E3-alpha-2
  • Ubiquitin-protein ligase E3-alpha-II

Background

Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00197131-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-553
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88409
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-94071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-76836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UBR2 Antibody (H00023304-M01) (0)

There are no publications for UBR2 Antibody (H00023304-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBR2 Antibody (H00023304-M01) (0)

There are no reviews for UBR2 Antibody (H00023304-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBR2 Antibody (H00023304-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBR2 Products

Bioinformatics Tool for UBR2 Antibody (H00023304-M01)

Discover related pathways, diseases and genes to UBR2 Antibody (H00023304-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR2 Antibody (H00023304-M01)

Discover more about diseases related to UBR2 Antibody (H00023304-M01).
 

Pathways for UBR2 Antibody (H00023304-M01)

View related products by pathway.

PTMs for UBR2 Antibody (H00023304-M01)

Learn more about PTMs related to UBR2 Antibody (H00023304-M01).

Blogs on UBR2

There are no specific blogs for UBR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBR2 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR2
Entrez
OMIM
Uniprot