UBE2R1/CDC34 Antibody [PerCP] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human UBE2R1/CDC34 (NP_004350.1).
Sequence: KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CDC34 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for UBE2R1/CDC34 Antibody [PerCP]
Background
Cdc34 is a ubiquitin conjugating enzyme (UBC) or E2 that has been shown to be essential for the G1 to S phase transition in S. cerevisiae. Human Cdc34 fully complements the budding yeast Cdc34 temperature sensitive mutant phenotype. In egg extracts of the frog Xenopus laevis, Cdc34 has been shown to be required for the onset of DNA replication and appears to function in a multi-protein complex. Also, Cdc34 is highly conserved among vertebrates and is likely to function in a similar manner in all eukaryotes to regulate the start of DNA synthesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Publications for UBE2R1/CDC34 Antibody (NBP3-38156PCP) (0)
There are no publications for UBE2R1/CDC34 Antibody (NBP3-38156PCP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UBE2R1/CDC34 Antibody (NBP3-38156PCP) (0)
There are no reviews for UBE2R1/CDC34 Antibody (NBP3-38156PCP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UBE2R1/CDC34 Antibody (NBP3-38156PCP) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UBE2R1/CDC34 Products
Research Areas for UBE2R1/CDC34 Antibody (NBP3-38156PCP)
Find related products by research area.
|
Blogs on UBE2R1/CDC34