UBE2E3 Antibody

Images

 
Western Blot: UBE2E3 Antibody [NBP1-86884] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: UBE2E3 Antibody [NBP1-86884] - Staining of human cell line U-2 OS shows positivity in nucleoli.
Immunohistochemistry-Paraffin: UBE2E3 Antibody [NBP1-86884] - Staining of human testis shows cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE2E3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2E3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBE2E3 Protein (NBP1-86884PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2E3 Antibody

  • E2-23K
  • EC 6.3.2.19
  • UBCE4
  • UbcH9
  • UBCH9ubiquitin-conjugating enzyme E2E 3 (homologous to yeast UBC4/5)
  • UbcM2
  • UBE2E3
  • Ubiquitin carrier protein E3
  • ubiquitin-conjugating enzyme E2 E3
  • Ubiquitin-conjugating enzyme E2-23 kDa
  • ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
  • Ubiquitin-protein ligase E3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92556
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78983
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NB100-56484
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
E2-695
Species: Hu
AF1555
Species: Hu
Applications: WB
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-54974
Species: Hu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P

Publications for UBE2E3 Antibody (NBP1-86884) (0)

There are no publications for UBE2E3 Antibody (NBP1-86884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2E3 Antibody (NBP1-86884) (0)

There are no reviews for UBE2E3 Antibody (NBP1-86884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2E3 Antibody (NBP1-86884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2E3 Products

Bioinformatics Tool for UBE2E3 Antibody (NBP1-86884)

Discover related pathways, diseases and genes to UBE2E3 Antibody (NBP1-86884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2E3 Antibody (NBP1-86884)

Discover more about diseases related to UBE2E3 Antibody (NBP1-86884).
 

Pathways for UBE2E3 Antibody (NBP1-86884)

View related products by pathway.

PTMs for UBE2E3 Antibody (NBP1-86884)

Learn more about PTMs related to UBE2E3 Antibody (NBP1-86884).

Blogs on UBE2E3

There are no specific blogs for UBE2E3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2E3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2E3
Entrez