UbcH6/UBE2E1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of UbcH6/UBE2E1. Peptide sequence: ETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UBE2E1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for UbcH6/UBE2E1 Antibody - BSA Free
Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: EnzAct
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu
Applications: WB
Publications for UbcH6/UBE2E1 Antibody (NBP2-86036) (0)
There are no publications for UbcH6/UBE2E1 Antibody (NBP2-86036).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UbcH6/UBE2E1 Antibody (NBP2-86036) (0)
There are no reviews for UbcH6/UBE2E1 Antibody (NBP2-86036).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UbcH6/UBE2E1 Antibody (NBP2-86036) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UbcH6/UBE2E1 Products
Research Areas for UbcH6/UBE2E1 Antibody (NBP2-86036)
Find related products by research area.
|
Blogs on UbcH6/UBE2E1