UbcH5b/UBE2D2 Antibody (4A1)

Images

 
Western Blot: UbcH5b/UBE2D2 Antibody (4A1) [H00007322-M02] - UBE2D2 monoclonal antibody (M02), clone 4A1. Analysis of UBE2D2 expression in Raw 264.7.
Immunohistochemistry-Paraffin: UbcH5b/UBE2D2 Antibody (4A1) [H00007322-M02] - Analysis of monoclonal antibody to UBE2D2 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: UbcH5b/UBE2D2 Antibody (4A1) [H00007322-M02] - UBE2D2 monoclonal antibody (M02), clone 4A1. Analysis of UBE2D2 expression in PC-12.
Western Blot: UbcH5b/UBE2D2 Antibody (4A1) [H00007322-M02] - UBE2D2 monoclonal antibody (M02), clone 4A1 Analysis of UBE2D2 expression in NIH/3T3.
Sandwich ELISA: UbcH5b/UBE2D2 Antibody (4A1) [H00007322-M02] - Detection limit for recombinant GST tagged UBE2D2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UbcH5b/UBE2D2 Antibody (4A1) Summary

Immunogen
UBE2D2 (NP_003330, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS
Specificity
UBE2D2 (4A1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2D2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Control
UbcH5b/UBE2D2 Knockout HeLa Cell Lysate
Publications
Read Publication using H00007322-M02.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UbcH5b/UBE2D2 Antibody (4A1)

  • E2(17)KB2
  • EC 6.3.2.19
  • PUBC1
  • UBC4/5
  • UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5)
  • UBC5B
  • UBCH4
  • UbcH5b
  • UBE2D2
  • Ubiquitin carrier protein D2
  • ubiquitin-conjugating enzyme E2 D2
  • Ubiquitin-conjugating enzyme E2(17)KB 2
  • Ubiquitin-conjugating enzyme E2-17 kDa 2
  • ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
  • Ubiquitin-protein ligase D2

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6609
Species: Hu, Mu
Applications: WB, IHC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00007337-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-67835
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP

Publications for UbcH5b/UBE2D2 Antibody (H00007322-M02)(1)

Reviews for UbcH5b/UBE2D2 Antibody (H00007322-M02) (0)

There are no reviews for UbcH5b/UBE2D2 Antibody (H00007322-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UbcH5b/UBE2D2 Antibody (H00007322-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UbcH5b/UBE2D2 Products

Bioinformatics Tool for UbcH5b/UBE2D2 Antibody (H00007322-M02)

Discover related pathways, diseases and genes to UbcH5b/UBE2D2 Antibody (H00007322-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH5b/UBE2D2 Antibody (H00007322-M02)

Discover more about diseases related to UbcH5b/UBE2D2 Antibody (H00007322-M02).
 

Pathways for UbcH5b/UBE2D2 Antibody (H00007322-M02)

View related products by pathway.

PTMs for UbcH5b/UBE2D2 Antibody (H00007322-M02)

Learn more about PTMs related to UbcH5b/UBE2D2 Antibody (H00007322-M02).
 

Research Areas for UbcH5b/UBE2D2 Antibody (H00007322-M02)

Find related products by research area.

Blogs on UbcH5b/UBE2D2

There are no specific blogs for UbcH5b/UBE2D2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH5b/UBE2D2 Antibody (4A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2D2
Entrez
OMIM
Uniprot