Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP3-03879] - Western blot analysis of extracts of various cell lines, using TPST2 antibody (NBP3-03879) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free [Tyrosylprotein Sulfotransferase 2/TPST2] - Western blot analysis of lysates from U-2 OS cells using Tyrosylprotein Sulfotransferase 2/TPST2 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free (NBP3-03879) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human Tyrosylprotein Sulfotransferase 2/TPST2 (NP_003586.3). SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPST2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100 - 1:500
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

• EC 2.8.2.20
• TPST2
• TPST-2
• tyrosylprotein phosphotransferase 2
• Tyrosylprotein Sulfotransferase 2
• tyrosylprotein sulfotransferase 2protein-tyrosine sulfotransferase 2
• tyrosylprotein sulfotransferase-2

Background

The protein encoded by the TPST2 gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879). (Showing 1 - 1 of 1 FAQ).

1. What is the lower limit of detection for TPST2 in Western blot?
   • We generally do not test the limits of detection for our antibodies as this time. I apologize for the inconvenience.

Bioinformatics

• Gene Symbol: TPST2