Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human Tyrosylprotein Sulfotransferase 2/TPST2 (NP_003586.3). SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TPST2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 - 1:500
|
| Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free
Background
The protein encoded by the TPST2 gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Species: Hu
Applications: ELISA, WB
Publications for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879) (0)
There are no publications for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879) (0)
There are no reviews for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879). (Showing 1 - 1 of 1 FAQ).
-
What is the lower limit of detection for TPST2 in Western blot?
- We generally do not test the limits of detection for our antibodies as this time. I apologize for the inconvenience.
Secondary Antibodies
| |
Isotype Controls
|
Additional Tyrosylprotein Sulfotransferase 2/TPST2 Products
Research Areas for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP3-03879)
Find related products by research area.
|
Blogs on Tyrosylprotein Sulfotransferase 2/TPST2