TXNDC9 Antibody

Images

 
Western Blot: TXNDC9 Antibody [NBP1-89052] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TXNDC9 Antibody [NBP1-89052] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli, nuclear membrane and cytoplasm.
Immunohistochemistry-Paraffin: TXNDC9 Antibody [NBP1-89052] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Western Blot: TXNDC9 Antibody [NBP1-89052] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-616

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TXNDC9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXNDC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TXNDC9 Protein (NBP1-89052PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TXNDC9 Antibody

  • APACDProtein 1-4
  • ATP binding protein associated with cell differentiation
  • ATP-binding protein associated with cell differentiation
  • PHLP3
  • thioredoxin domain containing 9
  • thioredoxin domain-containing protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-13744
Species: Hu
Applications: IHC, IHC-P
NBP1-83172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
H00009669-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13219
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81422
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89052
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TXNDC9 Antibody (NBP1-89052) (0)

There are no publications for TXNDC9 Antibody (NBP1-89052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNDC9 Antibody (NBP1-89052) (0)

There are no reviews for TXNDC9 Antibody (NBP1-89052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TXNDC9 Antibody (NBP1-89052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNDC9 Products

Bioinformatics Tool for TXNDC9 Antibody (NBP1-89052)

Discover related pathways, diseases and genes to TXNDC9 Antibody (NBP1-89052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNDC9 Antibody (NBP1-89052)

Discover more about diseases related to TXNDC9 Antibody (NBP1-89052).
 

Pathways for TXNDC9 Antibody (NBP1-89052)

View related products by pathway.

Blogs on TXNDC9

There are no specific blogs for TXNDC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNDC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNDC9