TXNDC12 Antibody - BSA Free

Western Blot: TXNDC12 Antibody [NBP3-10018] - Western blot analysis of TXNDC12 in Human Large Intestine Tumor lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TXNDC12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TXNDC12 Antibody - BSA Free (NBP3-10018) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC12 (NP_056997). Peptide sequence METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXNDC12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TXNDC12 Antibody - BSA Free

• AG1
• AGR1
• anterior gradient homolog 1
• EC 1.8.4.2
• endoplasmic reticulum protein ERp19
• Endoplasmic reticulum resident protein 18
• Endoplasmic reticulum resident protein 19
• endoplasmic reticulum thioredoxin superfamily member, 18 kDa
• ER protein 18
• ER protein 19
• ERP16
• ERp18
• ERP18AG1
• ERP19
• hAG-1
• hTLP19
• PDIA16
• protein disulfide isomerase family A, member 16
• thioredoxin domain containing 12 (endoplasmic reticulum)
• thioredoxin domain-containing protein 12
• Thioredoxin-like protein p19
• TLP19
• TLP19hTLP19
• TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)

Background

TXNDC12 belongs to the thioredoxin superfamily (see TXN; MIM 187700). Members of this superfamily possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors (Liu et al., 2003 (PubMed 14557066)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TXNDC12