TUSC4 Antibody


Western Blot: TUSC4 Antibody [NBP1-79375] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: TUSC4 Antibody [NBP1-79375] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue ...read more

Product Details

Product Discontinued
View other related TUSC4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TUSC4 Antibody Summary

Please note that the 0.05mg size is provided in lyophilized form while 0.01mg sample size is provided in reconstituted form
Synthetic peptide directed towards the N terminal of human TUSC4The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose lyophilized with the antibody.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified
Reconstitution Instructions
Centrifuge at 12,000 x g for 20 seocnds. Reconstitute with 50 ul distilled water to a final concentration of 1.0 mg/ml. in PBS buffer. Vortex followed by centrifuge again to pellet the solution.


Application Notes
This is a rabbit polyclonal antibody against TUSC4 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TUSC4 Antibody

  • G21 protein
  • Gene 21 protein
  • homologous to yeast nitrogen permease (candidate tumor suppressor)
  • nitrogen permease regulator 2-like protein
  • nitrogen permease regulator-like 2 (S. cerevisiae)
  • NPR2
  • NPR2L2810446G01Rik
  • NPRL2
  • Tumor suppressor candidate 4NPR2-like protein
  • TUSC4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF

Publications for TUSC4 Antibody (NBP1-79375) (0)

There are no publications for TUSC4 Antibody (NBP1-79375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUSC4 Antibody (NBP1-79375) (0)

There are no reviews for TUSC4 Antibody (NBP1-79375). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TUSC4 Antibody (NBP1-79375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TUSC4 Antibody Products

Related Products by Gene

Bioinformatics Tool for TUSC4 Antibody (NBP1-79375)

Discover related pathways, diseases and genes to TUSC4 Antibody (NBP1-79375). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUSC4 Antibody (NBP1-79375)

Discover more about diseases related to TUSC4 Antibody (NBP1-79375).

Pathways for TUSC4 Antibody (NBP1-79375)

View related products by pathway.

PTMs for TUSC4 Antibody (NBP1-79375)

Learn more about PTMs related to TUSC4 Antibody (NBP1-79375).

Research Areas for TUSC4 Antibody (NBP1-79375)

Find related products by research area.

Blogs on TUSC4

There are no specific blogs for TUSC4, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol NPRL2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-79375 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.