TULP3 Antibody

Images

 
Western Blot: TULP3 Antibody [NBP1-86897] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TULP3 Antibody [NBP1-86897] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TULP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TULP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TULP3 Protein (NBP1-86897PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TULP3 Antibody

  • MGC45295
  • tubby like protein 3
  • tubby-related protein 3
  • TUBL3Tubby-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20758
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007288-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TULP3 Antibody (NBP1-86897) (0)

There are no publications for TULP3 Antibody (NBP1-86897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TULP3 Antibody (NBP1-86897) (0)

There are no reviews for TULP3 Antibody (NBP1-86897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TULP3 Antibody (NBP1-86897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TULP3 Products

Bioinformatics Tool for TULP3 Antibody (NBP1-86897)

Discover related pathways, diseases and genes to TULP3 Antibody (NBP1-86897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TULP3 Antibody (NBP1-86897)

Discover more about diseases related to TULP3 Antibody (NBP1-86897).
 

Pathways for TULP3 Antibody (NBP1-86897)

View related products by pathway.

Research Areas for TULP3 Antibody (NBP1-86897)

Find related products by research area.

Blogs on TULP3.

Can Tubby Make You Tubby?
The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TULP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TULP3