TTLL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TTLL1 Antibody [NBP2-13491] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
Immunohistochemistry-Paraffin: TTLL1 Antibody [NBP2-13491] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTLL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEIL YDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTLL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTLL1 Protein (NBP2-13491PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTLL1 Antibody

  • C22orf7
  • catalytic subunit of neural tubulin polyglutamylase
  • EC 6.-
  • HS323M22B
  • KIAA0173
  • PGs3
  • probable tubulin polyglutamylase TTLL1
  • Tubulin polyglutamylase complex subunit 3
  • tubulin tyrosine ligase-like 1
  • tubulin tyrosine ligase-like family, member 1
  • tubulin-tyrosine ligase
  • Tubulin--tyrosine ligase-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57533
Species: Hu
Applications: ICC/IF
H00284076-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7325
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-43837
Species: Hu, Mu, Rt, Dr, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88467
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13491
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for TTLL1 Antibody (NBP2-13491) (0)

There are no publications for TTLL1 Antibody (NBP2-13491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTLL1 Antibody (NBP2-13491) (0)

There are no reviews for TTLL1 Antibody (NBP2-13491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TTLL1 Antibody (NBP2-13491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTLL1 Products

Bioinformatics Tool for TTLL1 Antibody (NBP2-13491)

Discover related pathways, diseases and genes to TTLL1 Antibody (NBP2-13491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTLL1 Antibody (NBP2-13491)

Discover more about diseases related to TTLL1 Antibody (NBP2-13491).
 

Pathways for TTLL1 Antibody (NBP2-13491)

View related products by pathway.

PTMs for TTLL1 Antibody (NBP2-13491)

Learn more about PTMs related to TTLL1 Antibody (NBP2-13491).

Blogs on TTLL1

There are no specific blogs for TTLL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTLL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTLL1