TTC7B Antibody

Images

 
Western Blot: TTC7B Antibody [NBP2-31782] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TTC7B Antibody [NBP2-31782] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31782] - Staining of human cerebral cortex shows strong positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC7B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HYHDALNIIDMALSEYPENFILLFSKVKLQSLCRGPDEALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTC7B Protein (NBP2-31782PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC7B Antibody

  • c14_5685
  • tetratricopeptide repeat domain 7 like 1
  • tetratricopeptide repeat domain 7B
  • tetratricopeptide repeat protein 7B
  • Tetratricopeptide repeat protein 7-like-1
  • TPR repeat protein 7B
  • TPR repeat protein 7-like-1
  • TTC7L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49346
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37308
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-690
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Fu, GP, Ha, Mk, Pa, Pm, Rb, Xp, Ye
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, CyTOF-ready, IF
NBP1-87235
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00056937-M01
Species: Hu
Applications: WB, ELISA
NBP2-31782
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TTC7B Antibody (NBP2-31782) (0)

There are no publications for TTC7B Antibody (NBP2-31782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC7B Antibody (NBP2-31782) (0)

There are no reviews for TTC7B Antibody (NBP2-31782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTC7B Antibody (NBP2-31782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC7B Products

Bioinformatics Tool for TTC7B Antibody (NBP2-31782)

Discover related pathways, diseases and genes to TTC7B Antibody (NBP2-31782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC7B Antibody (NBP2-31782)

Discover more about diseases related to TTC7B Antibody (NBP2-31782).
 

Pathways for TTC7B Antibody (NBP2-31782)

View related products by pathway.

Blogs on TTC7B

There are no specific blogs for TTC7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC7B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC7B
Uniprot