TTC3 Antibody (2D10)

Images

 
ELISA: TTC3 Antibody (2D10) [H00007267-M09] - Detection limit for recombinant GST tagged TTC3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TTC3 Antibody (2D10) Summary

Immunogen
TTC3 (NP_003307, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV
Specificity
TTC3 (2D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TTC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTC3 Antibody (2D10)

  • DCRR1tetratricopeptide repeat protein 3 (TPR repeat protein D)10RNF105DKFZp686M0150
  • E3 ubiquitin-protein ligase TTC3
  • EC 6.3.2.-
  • Protein DCRR1
  • RING finger protein 105
  • tetratricopeptide repeat domain 3
  • Tetratricopeptide repeat protein 3
  • TPR repeat protein 3
  • TPR repeat protein D
  • TPRDI
  • TPRDII
  • TPRDTPRDIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-57614
Species: Hu
Applications: ICC/IF
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
NB120-3446
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
NBP1-80900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84296
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TTC3 Antibody (H00007267-M09) (0)

There are no publications for TTC3 Antibody (H00007267-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC3 Antibody (H00007267-M09) (0)

There are no reviews for TTC3 Antibody (H00007267-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTC3 Antibody (H00007267-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC3 Products

Bioinformatics Tool for TTC3 Antibody (H00007267-M09)

Discover related pathways, diseases and genes to TTC3 Antibody (H00007267-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC3 Antibody (H00007267-M09)

Discover more about diseases related to TTC3 Antibody (H00007267-M09).
 

Pathways for TTC3 Antibody (H00007267-M09)

View related products by pathway.

PTMs for TTC3 Antibody (H00007267-M09)

Learn more about PTMs related to TTC3 Antibody (H00007267-M09).
 

Research Areas for TTC3 Antibody (H00007267-M09)

Find related products by research area.

Blogs on TTC3

There are no specific blogs for TTC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC3 Antibody (2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC3
Entrez
OMIM
Uniprot