TSKS Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TSKS |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TSKS Antibody - BSA Free
Background
TSKS is a novel putative serine/threonine kinase substrate gene (TSKS, for testis-specific kinase substrate) is likely the human homolog of the mouse testis-specific serine kinase substrate gene. TSKS exhibits high levels of expression exclusively in human testicular tissue. The expression of TSKS is downregulated in cancerous testicular tissue, in comparison to adjacent normal tissue. These observations suggest a role of TSKS in testicular physiology, most probably in the process of spermatogenesis or spermiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Am, Bv, Ch, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: EnzAct
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Publications for TSKS Antibody (NBP1-92539) (0)
There are no publications for TSKS Antibody (NBP1-92539).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TSKS Antibody (NBP1-92539) (0)
There are no reviews for TSKS Antibody (NBP1-92539).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TSKS Antibody (NBP1-92539) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TSKS Products
Research Areas for TSKS Antibody (NBP1-92539)
Find related products by research area.
|
Blogs on TSKS