TSGA2 Antibody - BSA Free

Staining of human cerebral cortex, fallopian tube, placenta and testis using Anti-RSPH1 antibody NBP1-89840 (A) shows similar protein distribution across tissues to independent antibody NBP1-89839 (B).

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89840] - Analysis in human fallopian tube and cerebral cortex tissues using NBP1-89840 antibody. Corresponding RSPH1 RNA-seq data are presented for the same tissues.

Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89840] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Staining of human placenta shows no positivity in trophoblastic cells as expected.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and RSPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSGA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSGA2 Antibody - BSA Free (NBP1-89840) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TSGA2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RSPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 30811583)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TSGA2 Protein (NBP1-89840PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TSGA2 Antibody - BSA Free

• Cancer/testis antigen 79
• CT79
• FLJ32753
• h-meichroacidin
• Male meiotic metaphase chromosome-associated acidic protein
• meichroacidin
• radial spoke head 1 homolog (Chlamydomonas)
• radial spoke head 1 homolog
• RSP44
• RSPH10A
• testes specific A2 homolog
• testes specific gene A2 homolog
• testis specific A2 homolog (mouse)
• testis specific A2 homolog
• Testis-specific gene A2 protein
• TSA2MGC126568
• TSGA2MGC141927

Background

TSGA2 may play an important role in male meiosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSGA2 Antibody (NBP1-89840)(2)

Publications using NBP1-89840

• Li Y, Sha Y, Wang X et al. DNAH2 is a novel candidate gene associated with multiple morphological abnormalities of the sperm flagella Clin. Genet. 2019-02-27 [PMID: 30811583] (ICC/IF, Human)
• Uhlen M, Oksvold P, Algenas C et al. Antibody-based Protein Profiling of the Human Chromosome 21. Mol Cell Proteomics 2012-03-01 [PMID: 22042635]

Bioinformatics

• Gene Symbol: RSPH1