TSC2 Recombinant Protein Antigen

Images

 
There are currently no images for TSC2 Protein (NBP1-82849PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TSC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSC2.

Source: E. coli

Amino Acid Sequence: SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TSC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82849.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TSC2 Recombinant Protein Antigen

  • LAM
  • LAMFLJ43106
  • TSC2
  • TSC4
  • Tuberin
  • Tuberous sclerosis 2 protein
  • tuberous sclerosis 2

Background

Tuberous sclerosis complex-2 (TCS2 also known as Tuberin) is a tumor suppressor that forms a complex with TSC1 (Hamartin ) and this complex is known to control various cellular functions including cell cycle, endocytosis, adhesion, and transcription (1). The C-terminal region of TSC2 contains a GTPase-activating protein (GAP) domain which interacts with Rap1, Rab5 and Rheb (2). The TSC1/TSC2 complex inhibits phosphorylation of S6kinase and 4E-BP1 through inactivation of mTOR (3). Additionally, binding of 14-3-3 beta to TSC2 at Ser1210 reduce the ability of the complex to inhibit phosphorylation of S6 kinase (4). Phosphorylation by ATK at Ser924 and Thr1518 inactivates TSC2 and disrupts its interaction with TSC1 (5). Tuberous sclerosis (TSC), an autosomal dominant disorder that affects 1 in 6000 individuals, is caused by a mutation in either the TSC1 or TSC2 tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NBP2-13426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
AF6270
Species: Hu
Applications: ICC
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB

Publications for TSC2 Protein (NBP1-82849PEP) (0)

There are no publications for TSC2 Protein (NBP1-82849PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSC2 Protein (NBP1-82849PEP) (0)

There are no reviews for TSC2 Protein (NBP1-82849PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TSC2 Protein (NBP1-82849PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSC2 Products

Array NBP1-82849PEP

Research Areas for TSC2 Protein (NBP1-82849PEP)

Find related products by research area.

Blogs on TSC2.

Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi...  Read full blog post.

TSC2 - GTPase activating protein involved in cell cycle inhibition
TSC2 is a tumor suppressor gene that encodes a 200 kDa protein called tuberin. TSC2 heterodimerizes with TSC1 to form a complex with GTPase-activating protein (GAP) activity. The C-terminus of TSC2 contains the GAP domain responsible for this cata...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TSC2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TSC2