Recombinant Human Trypsin 1/PRSS1 Protein

Product Discontinued

Recombinant Human Trypsin 1/PRSS1 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-247 of Human PRSS1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: PRSS1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Trypsin 1/PRSS1 Protein

• Beta-trypsin
• Cationic trypsinogen
• digestive zymogen
• DKFZp779A0837
• EC 3.4.21
• EC 3.4.21.4
• FLJ57296
• MGC120175
• MGC149362
• nonfunctional trypsin 1
• protease, serine, 1 (trypsin 1)
• PRSS1
• PTRYI
• Serine protease 1
• TRP1
• TRY1beta-trypsin
• TRY4
• Trygn16
• TRYP1
• Trypsin 1
• Trypsin I
• trypsin-1
• Trypsinogen 1
• trypsinogen A

Background

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRSS1