Recombinant Human TRPC5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRPC5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 534-603 of Human TRPC5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGAT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPC5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRPC5 Protein

  • hTRP5
  • hTRP-5
  • short transient receptor potential channel 5
  • transient receptor potential cation channel, subfamily C, member 5
  • Transient receptor protein 5
  • TRP-5
  • TRP5transient receptor potential channel 5
  • TrpC5

Background

TRPC5 - transient receptor potential cation channel, subfamily C, member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12905
Species: Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-48318
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-98846
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for TRPC5 Partial Recombinant Protein (H00007224-Q01) (0)

There are no publications for TRPC5 Partial Recombinant Protein (H00007224-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPC5 Partial Recombinant Protein (H00007224-Q01) (0)

There are no reviews for TRPC5 Partial Recombinant Protein (H00007224-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPC5 Partial Recombinant Protein (H00007224-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPC5 Products

Bioinformatics Tool for TRPC5 Partial Recombinant Protein (H00007224-Q01)

Discover related pathways, diseases and genes to TRPC5 Partial Recombinant Protein (H00007224-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPC5 Partial Recombinant Protein (H00007224-Q01)

Discover more about diseases related to TRPC5 Partial Recombinant Protein (H00007224-Q01).
 

Pathways for TRPC5 Partial Recombinant Protein (H00007224-Q01)

View related products by pathway.

PTMs for TRPC5 Partial Recombinant Protein (H00007224-Q01)

Learn more about PTMs related to TRPC5 Partial Recombinant Protein (H00007224-Q01).
 

Research Areas for TRPC5 Partial Recombinant Protein (H00007224-Q01)

Find related products by research area.

Blogs on TRPC5

There are no specific blogs for TRPC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STIM1 Antibody (5A2)
H00006786-M01
TRPM2 Antibody
NB110-81601

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRPC5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPC5