| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to Troponin I type 2 (fast skeletal) The peptide sequence was selected from the N terminal of Troponin I type 2 (fast skeletal). Peptide sequence PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TNNI2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Publications using NBP1-57842 | Applications | Species |
|---|---|---|
| Rebolledo LFD Reverse Triggering Dyssynchrony and Its Impact on Diaphragm Injury During Mechanical Ventilation Thesis 2020-01-01 | ||
| Damiani LF, Engelberts D, Bastia L et al. Impact of Reverse Triggering Dyssynchrony During Lung-Protective Ventilation on Diaphragm Function: An Experimental Model American journal of respiratory and critical care medicine 2021-12-23 [PMID: 34941477] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Troponin I type 2 (fast skeletal) Antibody (NBP1-57842)Find related products by research area.
|
|
Troponin I Type 2 - I stay with fast-twitch skeletal muscles only The protein Troponin I is a component of the heteromeric protein complex responsible for regulating both skeletal and cardiac muscle contraction. Troponin complex is made up of three parts: troponin I (TnI), troponin T (TnT), and troponin C (TnC). Eac... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.