Tropomyosin-1 Antibody [mFluor Violet 610 SE] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human Tropomyosin-1 (NP_001018008.1).
Sequence: MAGSSSLEAVRRKIRSLQEQADAAEERAGTLQRELDHERKLRETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TPM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for Tropomyosin-1 Antibody [mFluor Violet 610 SE]
Background
Tropomyosin is a rigid rod shaped protein closely associated with actin filaments. Non-muscle forms of tropomyosin have been identified in a wide range of cell types.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Publications for Tropomyosin-1 Antibody (NBP3-35171MFV610) (0)
There are no publications for Tropomyosin-1 Antibody (NBP3-35171MFV610).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tropomyosin-1 Antibody (NBP3-35171MFV610) (0)
There are no reviews for Tropomyosin-1 Antibody (NBP3-35171MFV610).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Tropomyosin-1 Antibody (NBP3-35171MFV610) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tropomyosin-1 Products
Research Areas for Tropomyosin-1 Antibody (NBP3-35171MFV610)
Find related products by research area.
|
Blogs on Tropomyosin-1