Tropomyosin-1 Antibody [FITC]

Product Discontinued

Tropomyosin-1 Antibody [FITC] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human Tropomyosin-1 (NP_001018008.1).
  
  Sequence:
  MAGSSSLEAVRRKIRSLQEQADAAEERAGTLQRELDHERKLRETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tropomyosin-1 Antibody [FITC]

• alpha tropomyosin
• alpha-tropomyosin
• C15orf13
• cardiomyopathy, hypertrophic 3
• chromosome 15 open reading frame 13
• CMD1Y
• CMH3
• HTM-alpha
• sarcomeric tropomyosin kappa
• TMSA
• tropomyosin 1 (alpha) isoform 1
• tropomyosin 1 (alpha) isoform 2
• tropomyosin 1 (alpha) isoform 3
• tropomyosin 1 (alpha) isoform 4
• tropomyosin 1 (alpha) isoform 5
• tropomyosin 1 (alpha) isoform 6
• tropomyosin 1 (alpha) isoform 7
• tropomyosin 1 (alpha)
• tropomyosin alpha-1 chain
• tropomyosin-1

Background

Tropomyosin is a rigid rod shaped protein closely associated with actin filaments. Non-muscle forms of tropomyosin have been identified in a wide range of cell types.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPM1