Tropomodulin 1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human Tropomodulin 1. Peptide sequence: MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQ The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TMOD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Tropomodulin 1 Antibody - BSA Free
Background
Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament. which in turn defines the geometry of the membrane skeleton. May play an important role in regulating the organization of actin filaments by preferentially binding to a specific tropomyosin isoform at its N-terminus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Ze
Applications: WB
Species: Hu
Applications: WB
Publications for Tropomodulin 1 Antibody (NBP2-88487) (0)
There are no publications for Tropomodulin 1 Antibody (NBP2-88487).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tropomodulin 1 Antibody (NBP2-88487) (0)
There are no reviews for Tropomodulin 1 Antibody (NBP2-88487).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Tropomodulin 1 Antibody (NBP2-88487) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tropomodulin 1 Products
Research Areas for Tropomodulin 1 Antibody (NBP2-88487)
Find related products by research area.
|
Blogs on Tropomodulin 1