TRM1 Antibody

Images

 
Immunohistochemistry-Paraffin: TRM1 Antibody [NBP1-82198] - TRMT1 Antibody [NBP1-82198] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 24576683)
Control Peptide
TRM1 Recombinant Protein Antigen (NBP1-82198PEP)
Publications
Read Publication using
NBP1-82198 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Reactivity in mouse from verified custormer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRM1 Antibody

  • EC 2.1.1.32
  • FLJ20244
  • N(2)-N(2)-dimethylguanosine tRNA methyltransferase
  • TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae)
  • TRM1
  • tRNA 2,2-dimethylguanosine-26 methyltransferase
  • tRNA(guanine-26, N(2)-N(2)) methyltransferase
  • tRNA(m(2,2)G26)dimethyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98350
Species: Rt
Applications: WB
NBP2-27188
Species: Hu, Po, Ca, Pm
Applications: WB, Simple Western
NBP1-47791
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-20932
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-02136
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011116-M01
Species: Hu, Mu, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP2-46477
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IF
AF3600
Species: Hu
Applications: WB, ICC
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, IHC, IHC-P
NB100-59811
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IP, KD

Publications for TRM1 Antibody (NBP1-82198)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TRM1 Antibody (NBP1-82198) (0)

There are no reviews for TRM1 Antibody (NBP1-82198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRM1 Antibody (NBP1-82198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRM1 Products

Bioinformatics Tool for TRM1 Antibody (NBP1-82198)

Discover related pathways, diseases and genes to TRM1 Antibody (NBP1-82198). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRM1 Antibody (NBP1-82198)

Discover more about diseases related to TRM1 Antibody (NBP1-82198).

Blogs on TRM1

There are no specific blogs for TRM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT1
Uniprot