We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human TRIM59 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human TRIM59 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-403 of Human TRIM59

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRIM59
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
73.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM59 GST (N-Term) Protein

  • MGC129860
  • MGC129861
  • Mrf1
  • RING finger protein 104
  • RNF104MGC26631
  • TRIM57
  • tripartite motif containing 59
  • tripartite motif-containing 57
  • tripartite motif-containing 59
  • tripartite motif-containing protein 59
  • TSBF1MRF1
  • tumor suppressor TSBF1
  • Tumor suppressor TSBF-1

Background

Tripartite Motif Containing 59 (human TRIM59 theoretical molecular weight 47 kDa) belongs to a large family of 80 human isoforms. TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signaling genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM59 is implicated in a variety of cancer types (e.g., breast, colorectal, ovarian, and esophageal) and its expression serves as a marker of poor prognosis in cancer patients (2,3). Originally cloned from mice and named mouse RING finger 1 (Mrf1), TRIM59 mRNA is predominantly expressed in testis, spleen, brain, and heart tissues (3). TRIMs play a role in the process of autophagy where they serve as receptors, regulatory proteins, and adaptors for core autophagy proteins (e.g., Beclin1, ULK1, and ATG16L1) (1).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Wang, M., Chao, C., Luo, G., Wang, B., Zhan, X., Di, D., Qian, Y., & Zhang, X. (2019). Prognostic significance of TRIM59 for cancer patient survival: A systematic review and meta-analysis. Medicine, 98(48), e18024. https://doi.org/10.1097/MD.0000000000018024

3. Mandell, M. A., Saha, B., & Thompson, T. A. (2020). The Tripartite Nexus: Autophagy, Cancer, and Tripartite Motif-Containing Protein Family Members. Frontiers in Pharmacology. https://doi.org/10.3389/fphar.2020.00308

4. Chang, R., Xu, X., & Li, M. D. (2002). Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1. Gene. https://doi.org/10.1016/S0378-1119(02)00603-0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81037
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-86380
Species: Hu
Applications: ICC/IF, WB
NBP1-81021
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46998
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-31113
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-86906
Species: Hu
Applications: IHC,  IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2600
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
AF3760
Species: Hu
Applications: WB
1341-WF
Species: Hu
Applications: BA
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-85657
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5059
Species: Hu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00286827-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for TRIM59 Recombinant Protein (H00286827-P01) (0)

There are no publications for TRIM59 Recombinant Protein (H00286827-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM59 Recombinant Protein (H00286827-P01) (0)

There are no reviews for TRIM59 Recombinant Protein (H00286827-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM59 Recombinant Protein (H00286827-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM59 Products

Array H00286827-P01

Research Areas for TRIM59 Recombinant Protein (H00286827-P01)

Find related products by research area.

Blogs on TRIM59

There are no specific blogs for TRIM59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM59 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM59