TRIM59 Recombinant Protein Antigen

Product Discontinued

TRIM59 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM59.
  
  

  Source: E. coli

  Amino Acid Sequence: MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TRIM59
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82625.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM59 Recombinant Protein Antigen

• MGC129860
• MGC129861
• Mrf1
• RING finger protein 104
• RNF104MGC26631
• TRIM57
• tripartite motif containing 59
• tripartite motif-containing 57
• tripartite motif-containing 59
• tripartite motif-containing protein 59
• TSBF1MRF1
• tumor suppressor TSBF1
• Tumor suppressor TSBF-1

Background

Tripartite Motif Containing 59 (human TRIM59 theoretical molecular weight 47 kDa) belongs to a large family of 80 human isoforms. TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signaling genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM59 is implicated in a variety of cancer types (e.g., breast, colorectal, ovarian, and esophageal) and its expression serves as a marker of poor prognosis in cancer patients (2,3). Originally cloned from mice and named mouse RING finger 1 (Mrf1), TRIM59 mRNA is predominantly expressed in testis, spleen, brain, and heart tissues (3). TRIMs play a role in the process of autophagy where they serve as receptors, regulatory proteins, and adaptors for core autophagy proteins (e.g., Beclin1, ULK1, and ATG16L1) (1).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Wang, M., Chao, C., Luo, G., Wang, B., Zhan, X., Di, D., Qian, Y., & Zhang, X. (2019). Prognostic significance of TRIM59 for cancer patient survival: A systematic review and meta-analysis. Medicine, 98(48), e18024. https://doi.org/10.1097/MD.0000000000018024

3. Mandell, M. A., Saha, B., & Thompson, T. A. (2020). The Tripartite Nexus: Autophagy, Cancer, and Tripartite Motif-Containing Protein Family Members. Frontiers in Pharmacology. https://doi.org/10.3389/fphar.2020.00308

4. Chang, R., Xu, X., & Li, M. D. (2002). Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1. Gene. https://doi.org/10.1016/S0378-1119(02)00603-0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TRIM59