TRIM59 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related TRIM59 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-82625PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRIM59 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM59.

Source: E. coli

Amino Acid Sequence: MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM59
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82625.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM59 Recombinant Protein Antigen

  • MGC129860
  • MGC129861
  • Mrf1
  • RING finger protein 104
  • RNF104MGC26631
  • TRIM57
  • tripartite motif containing 59
  • tripartite motif-containing 57
  • tripartite motif-containing 59
  • tripartite motif-containing protein 59
  • TSBF1MRF1
  • tumor suppressor TSBF1
  • Tumor suppressor TSBF-1

Background

Tripartite Motif Containing 59 (human TRIM59 theoretical molecular weight 47 kDa) belongs to a large family of 80 human isoforms. TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signaling genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM59 is implicated in a variety of cancer types (e.g., breast, colorectal, ovarian, and esophageal) and its expression serves as a marker of poor prognosis in cancer patients (2,3). Originally cloned from mice and named mouse RING finger 1 (Mrf1), TRIM59 mRNA is predominantly expressed in testis, spleen, brain, and heart tissues (3). TRIMs play a role in the process of autophagy where they serve as receptors, regulatory proteins, and adaptors for core autophagy proteins (e.g., Beclin1, ULK1, and ATG16L1) (1).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Wang, M., Chao, C., Luo, G., Wang, B., Zhan, X., Di, D., Qian, Y., & Zhang, X. (2019). Prognostic significance of TRIM59 for cancer patient survival: A systematic review and meta-analysis. Medicine, 98(48), e18024. https://doi.org/10.1097/MD.0000000000018024

3. Mandell, M. A., Saha, B., & Thompson, T. A. (2020). The Tripartite Nexus: Autophagy, Cancer, and Tripartite Motif-Containing Protein Family Members. Frontiers in Pharmacology. https://doi.org/10.3389/fphar.2020.00308

4. Chang, R., Xu, X., & Li, M. D. (2002). Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1. Gene. https://doi.org/10.1016/S0378-1119(02)00603-0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81037
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-86380
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP
MAB8175
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-46998
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-31113
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-86906
Species: Hu
Applications: IHC,  IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-2600
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
AF3760
Species: Hu
Applications: WB
1341-WF
Species: Hu
Applications: BA
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-85657
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5059
Species: Hu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for TRIM59 Recombinant Protein Antigen (NBP1-82625PEP) (0)

There are no publications for TRIM59 Recombinant Protein Antigen (NBP1-82625PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM59 Recombinant Protein Antigen (NBP1-82625PEP) (0)

There are no reviews for TRIM59 Recombinant Protein Antigen (NBP1-82625PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRIM59 Recombinant Protein Antigen (NBP1-82625PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM59 Products

Array NBP1-82625PEP

Research Areas for TRIM59 Recombinant Protein Antigen (NBP1-82625PEP)

Find related products by research area.

Blogs on TRIM59

There are no specific blogs for TRIM59, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM59 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM59