TRIM44 Antibody

Images

 
Western Blot: TRIM44 Antibody [NBP2-31681] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: TRIM44 Antibody [NBP2-31681] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM44 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM44 Protein (NBP2-31681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM44 Antibody

  • DIPBMGC3490
  • HSA249128
  • MC7
  • Protein DIPB
  • tripartite motif containing 44
  • tripartite motif-containing 44
  • tripartite motif-containing protein 44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009060-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for TRIM44 Antibody (NBP2-31681) (0)

There are no publications for TRIM44 Antibody (NBP2-31681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM44 Antibody (NBP2-31681) (0)

There are no reviews for TRIM44 Antibody (NBP2-31681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM44 Antibody (NBP2-31681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM44 Products

Bioinformatics Tool for TRIM44 Antibody (NBP2-31681)

Discover related pathways, diseases and genes to TRIM44 Antibody (NBP2-31681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM44 Antibody (NBP2-31681)

Discover more about diseases related to TRIM44 Antibody (NBP2-31681).
 

Pathways for TRIM44 Antibody (NBP2-31681)

View related products by pathway.

PTMs for TRIM44 Antibody (NBP2-31681)

Learn more about PTMs related to TRIM44 Antibody (NBP2-31681).

Blogs on TRIM44

There are no specific blogs for TRIM44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM44
Uniprot