TRIM38 Recombinant Protein Antigen

Images

 
There are currently no images for TRIM38 Protein (NBP1-87126PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRIM38 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM38.

Source: E.coli

Amino Acid Sequence: LHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM38
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87126.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TRIM38 Recombinant Protein Antigen

  • MGC8946
  • RING finger protein 15RORETRo/SSA ribonucleoprotein homolog
  • RNF15
  • RoRet
  • TRIM38
  • tripartite motif containing 38
  • tripartite motif-containing 38
  • tripartite motif-containing protein 38
  • Zinc finger protein RoRet
  • zinc-finger protein RoRet

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM38 Protein (NBP1-87126PEP) (0)

There are no publications for TRIM38 Protein (NBP1-87126PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM38 Protein (NBP1-87126PEP) (0)

There are no reviews for TRIM38 Protein (NBP1-87126PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TRIM38 Protein (NBP1-87126PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM38 Products

Bioinformatics Tool for TRIM38 Protein (NBP1-87126PEP)

Discover related pathways, diseases and genes to TRIM38 Protein (NBP1-87126PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM38 Protein (NBP1-87126PEP)

Discover more about diseases related to TRIM38 Protein (NBP1-87126PEP).
 

Pathways for TRIM38 Protein (NBP1-87126PEP)

View related products by pathway.

PTMs for TRIM38 Protein (NBP1-87126PEP)

Learn more about PTMs related to TRIM38 Protein (NBP1-87126PEP).
 

Research Areas for TRIM38 Protein (NBP1-87126PEP)

Find related products by research area.

Blogs on TRIM38

There are no specific blogs for TRIM38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM38 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM38
Entrez