TRIM16 Recombinant Protein Antigen

Images

 
There are currently no images for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

TRIM16 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM16.

Source: E. coli

Amino Acid Sequence: YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56990.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM16 Recombinant Protein Antigen

  • DKFZp434O1826
  • EBBPtripartite motif-containing 16
  • Estrogen-responsive B box protein
  • tripartite motif containing 16
  • tripartite motif-containing protein 16

Background

TRIM16 was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

251-KG
Species: Hu
Applications: BA
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
AF4708
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NB200-323
Species: Hu, Rt
Applications: WB
NBP3-16627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46214
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP1-33405
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB200-209
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
H00010966-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
236-EG
Species: Hu
Applications: BA
NB100-56148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-56990PEP
Species: Hu
Applications: Binding Activity

Publications for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP) (0)

There are no publications for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP) (0)

There are no reviews for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM16 Products

Bioinformatics Tool for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP)

Discover related pathways, diseases and genes to TRIM16 Recombinant Protein Antigen (NBP2-56990PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP)

Discover more about diseases related to TRIM16 Recombinant Protein Antigen (NBP2-56990PEP).
 

Pathways for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP)

View related products by pathway.

PTMs for TRIM16 Recombinant Protein Antigen (NBP2-56990PEP)

Learn more about PTMs related to TRIM16 Recombinant Protein Antigen (NBP2-56990PEP).

Blogs on TRIM16

There are no specific blogs for TRIM16, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM16 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM16