TRIM10 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRIM10 Antibody [NBP2-13479] Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human Small intestine shows moderate cytoplasmic positivity in glandular cells.

Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Staining of human stomach shows weak cytoplasmic positivity in parietal cells.

Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIM10 Antibody - BSA Free (NBP2-13479) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: IQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQDGDILRQRDEFDLLVAGEICRFS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRIM10 Protein (NBP2-13479PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRIM10 Antibody - BSA Free

• B30-RING finger protein
• HERF1hematopoietic RING finger 1
• RFB30MGC141979
• RING finger protein 9
• RNF9tripartite motif protein 10
• tripartite motif containing 10
• tripartite motif-containing 10
• tripartite motif-containing protein 10
• Zn-finger protein

Background

TRIM10 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM10