TRIM10 Antibody

Images

 
Immunohistochemistry-Paraffin: TRIM10 Antibody [NBP2-13479] Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQDG DILRQRDEFDLLVAGEICRFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM10 Protein (NBP2-13479PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM10 Antibody

  • B30-RING finger protein
  • HERF1hematopoietic RING finger 1
  • RFB30MGC141979
  • RING finger protein 9
  • RNF9tripartite motif protein 10
  • tripartite motif containing 10
  • tripartite motif-containing 10
  • tripartite motif-containing protein 10
  • Zn-finger protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46214
Species: Hu
Applications: WB, IHC
NLS1878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-45962
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56605
Species: Av, Bv, Sh
Applications: WB
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB100-534
Species: Hu
Applications: WB, IP
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13479
Species: Hu
Applications: IHC, IHC-P

Publications for TRIM10 Antibody (NBP2-13479) (0)

There are no publications for TRIM10 Antibody (NBP2-13479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM10 Antibody (NBP2-13479) (0)

There are no reviews for TRIM10 Antibody (NBP2-13479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM10 Antibody (NBP2-13479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM10 Products

Bioinformatics Tool for TRIM10 Antibody (NBP2-13479)

Discover related pathways, diseases and genes to TRIM10 Antibody (NBP2-13479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM10 Antibody (NBP2-13479)

Discover more about diseases related to TRIM10 Antibody (NBP2-13479).
 

Pathways for TRIM10 Antibody (NBP2-13479)

View related products by pathway.

Research Areas for TRIM10 Antibody (NBP2-13479)

Find related products by research area.

Blogs on TRIM10

There are no specific blogs for TRIM10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM10