TREX1 Recombinant Protein Antigen

Images

 
There are currently no images for TREX1 Recombinant Protein Antigen (NBP2-68672PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TREX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TREX1.

Source: E. coli

Amino Acid Sequence: VDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TREX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68672.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TREX1 Recombinant Protein Antigen

  • 3'-5' exonuclease TREX1
  • AGS1
  • Aicardi-Goutieres syndrome 1
  • CRV
  • DKFZp434J0310
  • DNase III
  • DRN3
  • EC 3.1.11.2
  • HERNS
  • three prime repair exonuclease 1,3' repair exonuclease 1

Background

TREX1 encodes the major 3'->5' DNA exonuclease in human cells. The protein is a non-processive exonuclease that may serve a proofreading function for a human DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, and Cree encephalitis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1277-JG
Species: Hu
Applications: BA
NBP1-88052
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02004
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91830
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76978
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-46717
Species: Hu
Applications: ELISA, IHC, IP, WB
NBP2-03285
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, PLA, Simple Western, WB
NBP1-91968
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-03331
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF3735
Species: Hu
Applications: IHC, WB
NBP2-16391
Species: Hu, Mu
Applications: ICC/IF, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB

Publications for TREX1 Recombinant Protein Antigen (NBP2-68672PEP) (0)

There are no publications for TREX1 Recombinant Protein Antigen (NBP2-68672PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TREX1 Recombinant Protein Antigen (NBP2-68672PEP) (0)

There are no reviews for TREX1 Recombinant Protein Antigen (NBP2-68672PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TREX1 Recombinant Protein Antigen (NBP2-68672PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TREX1 Products

Research Areas for TREX1 Recombinant Protein Antigen (NBP2-68672PEP)

Find related products by research area.

Blogs on TREX1.

Dinosaur Protein Names: Infographic
Trex1 the protein is involved in DNA damage response. Tyrannosaurus rex (T. rex) the dinosaur lived during the Cretaceous Period. Raptor the protein is a regulator of mTOR activity. Velociraptors the dinosaurs lived during the Cretaceous Period. Learn...  Read full blog post.

Trex1 (3'-5' exonuclease TREX1, DNase III)
This gene encodes the major 3' to 5' DNA exonuclease in human cells. The protein is a non-processive exonuclease that appears to provide proofreading for checkpoint signaling after DNA damage in response to oxidative stress and apoptosis. It is ubiqui...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TREX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TREX1