Transducin alpha Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Transducin alpha Antibody - BSA Free (NBP2-88455) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Transducin alpha. Peptide sequence: YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHM The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GNAT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Transducin alpha Antibody - BSA Free
Background
Vision involves the conversion of light into electrochemical signals that are processed by the retina and subsequently sent to and interpreted by the brain. The process of converting light into an electrochemical signal begins when the membrane-bound protein, rhodopsin, absorbs light within the retina. Photoexcitation of rhodopsin causes the cytoplasmic surface of the protein to become catalytically active. In the active state, rhodopsin activates transducin, a GTP binding protein. Once activated, transducin promotes the hydrolysis of cGMP by phosphodiesterase (PDE). The decrease of intracellular cGMP concentration causes the ion channels within the outer segment of the rod or cone to close, thus causing membrane hyperpolarization and, eventually, signal transmission. Rhodopsin activity is believed to be shut off by phosphorylation followed by binding of the soluble protein, arrestin. Transducin, once activated by rhodopsin, promotes the hydrolysis of cGMP by PDE. The subunit composition of transducin differs between different photoreceptor cells. Rod transducin consists of rod transducin alpha (Tr alpha), T beta, and T gamma. Cone transducin is composed of cone transducin alpha (Tc alpha), T beta and T gamma. Differential transducin subunit composition of transducin is believed to be responsible for the different light sensitivities between photoreceptive cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: DirELISA, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Publications for Transducin alpha Antibody (NBP2-88455) (0)
There are no publications for Transducin alpha Antibody (NBP2-88455).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Transducin alpha Antibody (NBP2-88455) (0)
There are no reviews for Transducin alpha Antibody (NBP2-88455).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Transducin alpha Antibody (NBP2-88455) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Transducin alpha Products
Research Areas for Transducin alpha Antibody (NBP2-88455)
Find related products by research area.
|
Blogs on Transducin alpha