Transcription factor E3 Antibody

Western Blot: Transcription factor E3 Antibody [NBP1-89976] - Analysis of TFE3 in total lysates of MIN6 mouse insulinoma while cell lysates. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human kidney shows moderate nuclear positivity in renal glomeruli and tubuli cells.

Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.

Simple Western: Transcription factor E3 Antibody [NBP1-89976] - Simple Western lane view shows a specific band for TFE3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Transcription factor E3 Antibody [NBP1-89976] - Electropherogram image(s) of corresponding Simple Western lane view. Transcription factor E3 antibody was used at 1:30 dilution on RT-4 lysate(s).

Product Discontinued

Transcription factor E3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFE3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Transcription factor E3 antibody validated for WB from a verified customer review.
• Control Peptide:

  Transcription factor E3 Protein (NBP1-89976PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23582324)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transcription factor E3 Antibody

• BHLHE33
• bHLHe33transcription factor E3
• Class E basic helix-loop-helix protein 33
• RCCP2
• TFEA
• transcription factor binding to IGHM enhancer 3
• transcription factor E family, member A
• Transcription factor for IgH enhancer

Background

TFE3, a member of the helix-loop-helix family of transcription factors, binds to the mu-E3 motif of the immunoglobulin heavy-chain enhancer and is expressed in many cell types (Henthorn et al., 1991 [PubMed 1685140]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transcription factor E3 Antibody (NBP1-89976)(5)

Publications using NBP1-89976

• Sun ZJ, Yu GT, Huang CF et al. Hypoxia induce TFE3 expression in head and neck squamous cell carcinoma. Oncotarget. 2016-02-10 [PMID: 26872381] (IF/IHC, Human)
• Takashima Y, Guo G, Loos R et al. Resetting Transcription Factor Control Circuitry toward Ground-State Pluripotency in Human. Cell 2014-09-11 [PMID: 25215486] (IF/IHC, Human)
• Gafni O, Weinberger L, Mansour AA et al. Derivation of novel human ground state naive pluripotent stem cells. Nature 2013-12-12 [PMID: 24172903] (ICC/IF)
• Betschinger J, Nichols J, Dietmann S et al. Exit from Pluripotency Is Gated by Intracellular Redistribution of the bHLH Transcription Factor Tfe3. Cell 2013-04-11 [PMID: 23582324]
• Hong SB, Oh H, Valera VA et al. Inactivation of the FLCN tumor suppressor gene induces TFE3 transcriptional activity by increasing its nuclear localization. PLoS One 2010-12-01 [PMID: 21209915]

Reviews for Transcription factor E3 Antibody (NBP1-89976) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Mouse, Pig.

reviewed by: Verified Customer WB Mouse 02/07/2018

Summary

• Application: Western Blot
• Sample Tested: Min6 mouse insulinoma whole cell lysate
• Species: Mouse
• Lot: K106812

reviewed by: Verified Customer ICC Pig 02/09/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: primary pig RPE
• Species: Pig
• Lot: E106019

Bioinformatics

• Gene Symbol: TFE3