Transcription factor E3 Antibody

Images

 
Western Blot: Transcription factor E3 Antibody [NBP1-89976] - Western blot analysis of TFE3 in total lysates of MIN6 mouse insulinoma while cell lysates. Customer review.
Immunocytochemistry/ Immunofluorescence: Transcription factor E3 Antibody [NBP1-89976] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Western Blot: Transcription factor E3 Antibody [NBP1-89976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Genetic Strategies: Western Blot: Transcription factor E3 Antibody [NBP1-89976] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TFE3 antibody. ...read more
Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human kidney shows moderate nuclear positivity in renal glomeruli and tubuli cells.
Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transcription factor E3 Antibody [NBP1-89976] - Staining in human placenta and pancreas tissues. Corresponding TFE3 RNA-seq data are presented for the same ...read more
Simple Western: Transcription factor E3 Antibody [NBP1-89976] - Simple Western lane view shows a specific band for TFE3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the ...read more
Simple Western: Transcription factor E3 Antibody [NBP1-89976] - Electropherogram image(s) of corresponding Simple Western lane view. Transcription factor E3 antibody was used at 1:30 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transcription factor E3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
Specificity
Specificity of human, mouse, rat Transcription factor E3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFE3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control
Transcription factor E3 Lysate (NBP2-64867)
Control Peptide
Transcription factor E3 Protein (NBP1-89976PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-89976 in the following applications:

Publications
Read Publications using
NBP1-89976 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23582324)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transcription factor E3 Antibody

  • BHLHE33
  • bHLHe33transcription factor E3
  • Class E basic helix-loop-helix protein 33
  • RCCP2
  • TFEA
  • transcription factor binding to IGHM enhancer 3
  • transcription factor E family, member A
  • Transcription factor for IgH enhancer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB100-1030
Species: Hu
Applications: WB, ChIP, PEP-ELISA
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-87152
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-43766
Species: Hu
Applications: WB, ICC/IF
NBP2-38290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-45460
Species: Hu, Mu, Rt, Po, Ch, Rb
Applications: WB, IHC, IP
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89976
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for Transcription factor E3 Antibody (NBP1-89976)(5)

Reviews for Transcription factor E3 Antibody (NBP1-89976) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Pig.

Reviews using NBP1-89976:
Filter by Applications
WB
(1)
ICC
(1)
All Applications
Filter by Species
Mouse
(1)
Pig
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Transcription factor E3 NBP1-89976
Enlarge
reviewed by:
Anonymous
WB Mouse 02/07/2018
View

Summary

ApplicationWestern Blot
Sample TestedMin6 mouse insulinoma whole cell lysate
SpeciesMouse
LotK106812
Immunocytochemistry Transcription factor E3 NBP1-89976
Enlarge
reviewed by:
Anonymous
ICC Pig 02/09/2017
View

Summary

ApplicationImmunocytochemistry
Sample Testedprimary pig RPE
SpeciesPig
LotE106019

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transcription factor E3 Antibody (NBP1-89976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Transcription factor E3 Antibody (NBP1-89976)

Discover related pathways, diseases and genes to Transcription factor E3 Antibody (NBP1-89976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transcription factor E3 Antibody (NBP1-89976)

Discover more about diseases related to Transcription factor E3 Antibody (NBP1-89976).
 

Pathways for Transcription factor E3 Antibody (NBP1-89976)

View related products by pathway.

PTMs for Transcription factor E3 Antibody (NBP1-89976)

Learn more about PTMs related to Transcription factor E3 Antibody (NBP1-89976).

Blogs on Transcription factor E3.

Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studied....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
02/07/2018
Application: WB
Species: Mouse

Anonymous
02/09/2017
Application: ICC
Species: Pig

Bioinformatics

Gene Symbol TFE3