TR4/NR2C2 Antibody (2A5)

Images

 
Western Blot: TR4/NR2C2 Antibody (2A5) [H00007182-M01] - Analysis of NR2C2 over-expressed 293 cell line, cotransfected with NR2C2 Validated Chimera RNAi ( Cat # H00007182-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Immunohistochemistry-Paraffin: TR4/NR2C2 Antibody (2A5) [H00007182-M01] - Analysis of monoclonal antibody to NR2C2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.
Western Blot: TR4/NR2C2 Antibody (2A5) [H00007182-M01] - Analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody (M01), clone 2A5.Lane 1: NR2C2 transfected lysate(65.414 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, KD
Clone
2A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TR4/NR2C2 Antibody (2A5) Summary

Immunogen
NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS
Localization
Nuclear
Specificity
NR2C2 - nuclear receptor subfamily 2, group C, member 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NR2C2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TR4/NR2C2 Antibody (2A5)

  • hTAK1
  • NR2C2
  • Nuclear hormone receptor TR4
  • nuclear receptor subfamily 2 group C member 2
  • nuclear receptor subfamily 2, group C, member 2
  • Orphan nuclear receptor TAK1
  • Orphan nuclear receptor TR4
  • TAK1
  • TAK1TR4TR2R1
  • Testicular receptor 4
  • TR4 nuclear hormone receptor
  • TR4

Background

TR4 (TAK1, NR2C2) is an orphan nuclear receptor. TR4 was originally cloned from lymphoblastoma Raji cells or mouse brain cDNA library. No ligand has been reported. Northern blot shows TR4 is transcribed as a 9kb mRNA in many tissues and as a 2.8kb mRNA in testis, mainly in spermatocytes. TR4 has two isoforms called TR4alpha1 and TR4 alpha2,which differ in 19 amino acids coded by two separate exons. Both products translated from the 9kb transcript are ubiquitously expressed. Since TR4 binds to the same elements for the RAR-RXR or TR-RXR heterodimers, TR4 may have an inhibitory effect for retinoic-acid mediated transactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

210-TA
Species: Hu
Applications: BA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF3578
Species: Hu, Mu
Applications: ICC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-46200
Species: Hu, Mu
Applications: IP, WB
D6050
Species: Hu
Applications: ELISA
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-71803
Species: Hu, Mu
Applications: IHC, IP, WB
201-LB/CF
Species: Hu
Applications: BA
H00007182-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, KD

Publications for TR4/NR2C2 Antibody (H00007182-M01) (0)

There are no publications for TR4/NR2C2 Antibody (H00007182-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR4/NR2C2 Antibody (H00007182-M01) (0)

There are no reviews for TR4/NR2C2 Antibody (H00007182-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TR4/NR2C2 Antibody (H00007182-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TR4/NR2C2 Products

Bioinformatics Tool for TR4/NR2C2 Antibody (H00007182-M01)

Discover related pathways, diseases and genes to TR4/NR2C2 Antibody (H00007182-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TR4/NR2C2 Antibody (H00007182-M01)

Discover more about diseases related to TR4/NR2C2 Antibody (H00007182-M01).
 

Pathways for TR4/NR2C2 Antibody (H00007182-M01)

View related products by pathway.

PTMs for TR4/NR2C2 Antibody (H00007182-M01)

Learn more about PTMs related to TR4/NR2C2 Antibody (H00007182-M01).
 

Research Areas for TR4/NR2C2 Antibody (H00007182-M01)

Find related products by research area.

Blogs on TR4/NR2C2

There are no specific blogs for TR4/NR2C2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TR4/NR2C2 Antibody (2A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C2
Entrez
OMIM
Uniprot