TR2/NR2C1 Recombinant Protein Antigen

Images

 
There are currently no images for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TR2/NR2C1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NR2C1.

Source: E.coli

Amino Acid Sequence: QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR2C1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55132. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TR2/NR2C1 Recombinant Protein Antigen

  • NR2C1
  • nuclear receptor subfamily 2 group C member 1
  • nuclear receptor subfamily 2, group C isoform
  • nuclear receptor subfamily 2, group C, member 1
  • Orphan nuclear receptor TR2
  • Testicular receptor 2
  • TR2 nuclear hormone receptor
  • TR2
  • TR2-11

Background

NR2C1 encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20619
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46228
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DY805
Species: Hu
Applications: ELISA
NBP2-20571
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
664-LI/CF
Species: Hu
Applications: BA
NBP2-94256
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
MAB356
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
NBP2-13674
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NLS5060
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31259
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NBP2-55132PEP
Species: Hu
Applications: AC

Publications for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP) (0)

There are no publications for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP) (0)

There are no reviews for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TR2/NR2C1 Products

Bioinformatics Tool for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP)

Discover related pathways, diseases and genes to TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP)

Discover more about diseases related to TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP).
 

Pathways for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP)

View related products by pathway.

PTMs for TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP)

Learn more about PTMs related to TR2/NR2C1 Recombinant Protein Antigen (NBP2-55132PEP).

Blogs on TR2/NR2C1

There are no specific blogs for TR2/NR2C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TR2/NR2C1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C1