Home » TPPP3 » TPPP3 Antibodies » TPPP3 Antibody

TPPP3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center.
Immunocytochemistry/ Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TPPP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL
Specificity
Specificity of human TPPP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPPP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPPP3 Protein (NBP2-13469PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPPP3 Antibody

  • brain specific protein
  • CGI-38
  • p20
  • p25gamma
  • TPPP/p20
  • tubulin polymerization-promoting protein family member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
EXOSC3 Antibody
NBP2-22261
Western Blot: EXOSC3 Antibody [NBP2-22261] - Whole cell lysate from 293T (15 and 50 ug), HeLa (50 ug), Jurkat (50 ug), and mouse NIH3T3 (50 ug) cells. NBP2-22261 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: EXOSC3 Antibody [NBP2-22261] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from 293T cells. Antibodies: NBP2-22261 used for IP at 6 ug/mg lysate. EXOSC3 was also immunoprecipitated by another rabbit anti-EXOSC3 antibody. For blotting immunoprecipitated EXOSC3, NBP2-22261 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(1 Publication)
Species: Hu, Mu, Ch
Applications: WB, IP
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human breast shows strong nuclear positivity in glandular cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Exosome Component
9 Antibody
NBP1-71702
Western Blot: Exosome Component 9 Antibody [NBP1-71702] - Analysis of EXOSC9 in A. HepG2 cell lysate and B. MCF7 cell lysate.
Immunocytochemistry/Immunofluorescence: Exosome Component 9 Antibody [NBP1-71702] - EXOSC9 antibody was tested at 1:100 in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: Exosome Component 9 Antibody [NBP1-71702] - Staining of EXOSC9 in mouse prostate.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(113 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - analysis of EXOSC10 in HeLa whole cell extracts treated with (1) si-control and (2) EXOSC10 siRNA using anti-EXOSC10 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
PDIA6 Antibody
NBP2-38213
Western Blot: PDIA6 Antibody [NBP2-38213] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PDIA6 antibody. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: PDIA6 Antibody [NBP2-38213] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining in human thyroid gland and skeletal muscle tissues using anti-PDIA6 antibody. Corresponding PDIA6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
SLC10A5 Antibody
NBP1-85965
Western Blot: SLC10A5 Antibody [NBP1-85965] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: SLC10A5 Antibody [NBP1-85965] - Staining of human cell line U-251MG shows positivity in plasma membrane.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human bone marrow shows distinct nuclear and cytoplasmic positivity in subsets of bone marrow poietic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Caspase-1 Antibody
(14F468)
NB100-56565
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - Analysis of Caspase-1 using a Caspase-1 monoclonal antibody. Human HeLa (A) and mouse NIH3T3 lysate probed with Caspase-1 antibody at 0.5 ug/ml and 2 ug/ml, respectively.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - IHC analysis of a formalin fixed paraffin embedded (FFPE) tissue section of human intestine using Caspase-1 antibody (clone 14F468) at 5ug/ml concentration (1:200 dilution). The primary antibody binding to Caspase 1 in cells was detected using HRP conjugated anti-Mouse secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This Caspase 1 antibody generated a diffused but specific cytoplasmic staining in columnar epithelia cells of villi, and a few cells depicted nuclear staining also. Only a subset of connective tissue cells in lamina propria depicted positivity (cytoplasmic) for this protein.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Formalin-fixed, paraffin-embedded adenocarcinoma of the rectum stained with Caspase-1 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(25 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
CENPV Antibody
NBP1-84545
Western Blot: CENPV Antibody [NBP1-84545] - Analysis in human cell line HEK 293.
Immunocytochemistry/Immunofluorescence: CENPV Antibody [NBP1-84545] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining in human testis and skin tissues using anti-CENPV antibody. Corresponding CENPV RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDK5 Activator 1
Antibody (739304)
MAB7357
Western blot shows lysates of human brain (cortex) tissue and human brain (hippocampus) tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human CDK5 Activator 1 Monoclonal Antibody (Catalog # MAB7357) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for CDK5 Activator 1 at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: WB
TPPP/p25 Antibody
NBP1-49833
Western Blot: TPPP/p25 Antibody [NBP1-49833] - (0.001ug/ml) staining of Mouse (A) and Rat (B) Brain lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP1-49833] - Staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: TPPP/p25 Antibody [NBP1-49833] - (0.001ug/ml) Analysis of Human Cerebellum lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Western Blot: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CDKN2B.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Species: Hu
Applications: WB, Flow, IHC
Myelin Protein
Zero Antibody
NB100-1607
Immunocytochemistry/Immunofluorescence: Myelin Protein Zero Antibody [NB100-1607] - Adult sciatic nerve, Po stained (green) can be seen in the myelin and Schwann cell processes surrounding the nodes of Ranvier. In this photomicrograph, rabbit antibodies against LAMP (red), and DAPI (blue) allows visualization of nuclei.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SF3B14 Antibody
NBP1-87431
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using anti-SF3B6 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.
Species: Hu
Applications: WB, ELISA, ICC/IF
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-71687] - ROBLD3 Antibody was tested at 1:100 in NIH/3T3 cells with FITC (green). Nuclei (Blue) were counterstained with DAPI (blue).
Immunohistochemistry: ROBLD3 Antibody [NBP1-71687] - Analysis of ROBLD3 in human renal cell carcinoma.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
TPPP3 Antibody
NBP2-13469
TPPP3 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TPPP3 Antibody (NBP2-13469) (0)

There are no publications for TPPP3 Antibody (NBP2-13469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPPP3 Antibody (NBP2-13469) (0)

There are no reviews for TPPP3 Antibody (NBP2-13469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TPPP3 Antibody (NBP2-13469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPPP3 Products

Bioinformatics Tool for TPPP3 Antibody (NBP2-13469)

Discover related pathways, diseases and genes to TPPP3 Antibody (NBP2-13469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPPP3 Antibody (NBP2-13469)

Discover more about diseases related to TPPP3 Antibody (NBP2-13469).
 

Pathways for TPPP3 Antibody (NBP2-13469)

View related products by pathway.

Blogs on TPPP3

There are no specific blogs for TPPP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPPP3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TPPP3