Home » TPPP3 » TPPP3 Antibodies » TPPP3 Antibody

TPPP3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Analysis in human fallopian tube and liver tissues. Corresponding TPPP3 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Analysis in human fallopian tube and liver tissues. Corresponding TPPP3 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human pancreas shows no postivity in exocrine glanular cells as expected.
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

TPPP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPPP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPPP3 Protein (NBP2-13469PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPPP3 Antibody

  • brain specific protein
  • CGI-38
  • p20
  • p25gamma
  • TPPP/p20
  • tubulin polymerization-promoting protein family member 3

Background

TPPP3 binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(12 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
EXOSC3 Antibody
NBP2-22261
Western Blot: EXOSC3 Antibody [NBP2-22261] - Whole cell lysate from 293T (15 and 50 ug), HeLa (50 ug), Jurkat (50 ug), and mouse NIH3T3 (50 ug) cells. NBP2-22261 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: EXOSC3 Antibody [NBP2-22261] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from 293T cells. Antibodies: NBP2-22261 used for IP at 6 ug/mg lysate. EXOSC3 was also immunoprecipitated by another rabbit anti-EXOSC3 antibody. For blotting immunoprecipitated EXOSC3, NBP2-22261 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(2 Publications)
Species: Ch, Hu, Mu
Applications: IP, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human tonsil shows strong nuclear positivity in non - germinal center cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Exosome Component
9 Antibody - BSA Free
NBP1-71702
Simple Western: Exosome Component 9 Antibody [NBP1-71702] - Simple Western lane view shows a specific band for Exosome Component 9 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: Exosome Component 9 Antibody [NBP1-71702] - EXOSC9 antibody was tested at 1:100 in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: Exosome Component 9 Antibody [NBP1-71702] - Staining of EXOSC9 in mouse prostate.
(2 Reviews)
(3 Publications)
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(200 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
PDIA6 Antibody
NBP1-57999
Western Blot: PDIA6 Antibody [NBP1-57999] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type : Mouse Brain lysate
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
SLC10A5 Antibody
NBP1-85965
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human liver shows strong membranous positivity in hepatocytes.
Species: Hu
Applications: IHC, IHC-P
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Caspase-1 Antibody
(14F468) - BSA Free
NB100-56565
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Tissue section of human intestine using Caspase-1 antibody (clone 14F468) at 5ug/ml concentration (1:200 dilution). The primary antibody binding to Caspase 1 in cells was detected using HRP conjugated anti-Mouse secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This Caspase 1 antibody generated a diffused but specific cytoplasmic staining in columnar epithelia cells of villi, and a few cells depicted nuclear staining also. Only a subset of connective tissue cells in lamina propria depicted positivity (cytoplasmic) for this protein.
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - P. gingivalis and its OMVs differentially induce inflammasome signaling and pyroptosis in murine macrophages. BMM were infected as before (2 h at MOI of 25:1, see Materials and Methods) with viable P. gingivalis (Pg), heat-killed-Pg (HK-Pg), OMVs, or heat-inactivated-OMVs (HI-OMVs) and the activation of inflammasome components in the lysates [or supernatants (sup) where indicated] measured after 24 h by Western blot; beta-actin serves as a loading control throughout. Western blot data are representative of at least three independent experiments. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fcimb.2017.00351/full), licensed under a CC-BY licence.
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - LukAB is a potent activator of Caspase 1. THP1 cells were intoxicated with 50 ng/mL LukAB for 1 hour and cell lysates were analyzed by immunoblot for Caspase 1 cleavage, which indicates activation. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.ppat.1004970) licensed under a CC-BY licence.
(62 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CENPV Antibody
NBP1-84546
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84546] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84546] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84546] - Staining in human testis and skin tissues using anti-CENPV antibody. Corresponding CENPV RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/Immunofluorescence: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunofluorescent analysis. Sample: DIV10 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Red: alpha Tubulin, stained by alpha Tubulin antibody [GT114] (NBP2-43837) diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TPPP/p25 Antibody
NBP2-34031
Western Blot: TPPP/p25 Antibody [NBP2-34031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral cortex tissue.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Staining of human cerebral cortex, liver, lower gastrointestinal and pancreas using Anti-TPPP antibody NBP2-34031 (A) shows similar protein distribution across tissues to independent antibody NBP1-80962 (B).
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Analysis in human cerebral cortex and liver tissues using NBP2-34031 antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry: p15INK4b/CDKN2B Antibody (OTI3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (OTI3B6) [NBP2-45603] - Analysis of Human pancreas tissue.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (OTI3B6) [NBP2-45603] - Analysis of Carcinoma of Human thyroid tissue.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Myelin Protein
Zero Antibody
NB100-1607
Immunohistochemistry: Myelin Protein Zero Antibody [NB100-1607] - In the image (a lower power tissue section through an adult sciatic nerve), Myelin Protein Zero (brown staining) can be seen in all of the myelinating Schwann cells.
Immunocytochemistry/Immunofluorescence: Myelin Protein Zero Antibody [NB100-1607] - Immunohistochemical staining of P-zero on a 4.0% paraformaldehyde-fixed, paraffin-embedded tissue section through the sciatic nerve of an adult mouse. (Green) P0 concentration was 1:1000 dilution, followed by fluorescein-labeled goat anti-chicken IgY (1:500 dilution). Red is actin. Blue is DAPI nuclear counterstain.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
SF3B14 Antibody
NBP1-87431
Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human breast, colon, skeletal muscle and testis using Anti-SF3B6 antibody NBP1-87431 (A) shows similar protein distribution across tissues to independent antibody NBP1-87430 (B).
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human colon shows moderate nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.
Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-71687] - ROBLD3 Antibody was tested at 1:100 in NIH/3T3 cells with FITC (green). Nuclei (Blue) were counterstained with DAPI (blue).
Immunohistochemistry: ROBLD3 Antibody [NBP1-71687] - Analysis of ROBLD3 in human renal cell carcinoma.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for TPPP3 Antibody (NBP2-13469) (0)

There are no publications for TPPP3 Antibody (NBP2-13469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPPP3 Antibody (NBP2-13469) (0)

There are no reviews for TPPP3 Antibody (NBP2-13469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TPPP3 Antibody (NBP2-13469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPPP3 Products

Bioinformatics Tool for TPPP3 Antibody (NBP2-13469)

Discover related pathways, diseases and genes to TPPP3 Antibody (NBP2-13469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPPP3 Antibody (NBP2-13469)

Discover more about diseases related to TPPP3 Antibody (NBP2-13469).
 

Pathways for TPPP3 Antibody (NBP2-13469)

View related products by pathway.

Research Areas for TPPP3 Antibody (NBP2-13469)

Find related products by research area.

Blogs on TPPP3

There are no specific blogs for TPPP3, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPPP3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TPPP3