TPPP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPPP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPPP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPPP3 Protein (NBP2-13469PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPPP3 Antibody

  • brain specific protein
  • CGI-38
  • p20
  • p25gamma
  • TPPP/p20
  • tubulin polymerization-promoting protein family member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB6798
Species: Hu
Applications: WB, ICC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13469
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TPPP3 Antibody (NBP2-13469) (0)

There are no publications for TPPP3 Antibody (NBP2-13469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPPP3 Antibody (NBP2-13469) (0)

There are no reviews for TPPP3 Antibody (NBP2-13469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TPPP3 Antibody (NBP2-13469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPPP3 Products

Bioinformatics Tool for TPPP3 Antibody (NBP2-13469)

Discover related pathways, diseases and genes to TPPP3 Antibody (NBP2-13469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPPP3 Antibody (NBP2-13469)

Discover more about diseases related to TPPP3 Antibody (NBP2-13469).
 

Pathways for TPPP3 Antibody (NBP2-13469)

View related products by pathway.

Blogs on TPPP3

There are no specific blogs for TPPP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPPP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPPP3