TPPP3 Antibody

Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Analysis in human fallopian tube and liver tissues. Corresponding TPPP3 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human pancreas shows no postivity in exocrine glanular cells as expected.

Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

TPPP3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPPP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TPPP3 Antibody

• brain specific protein
• CGI-38
• p20
• p25gamma
• TPPP/p20
• tubulin polymerization-promoting protein family member 3

Background

TPPP3 binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TPPP3 Antibody (NBP2-13469)(1)

Publication using NBP2-13469

• Xu X, Hou Y, Long N et al. TPPP3 promote epithelial-mesenchymal transition via Snail1 in glioblastoma Scientific reports 2023-10-20 [PMID: 37863960] (WB, Human)

Bioinformatics

• Gene Symbol: TPPP3